CPT1B Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of mouse heart using 82701-3-RR (same clone as 82701-3-PBS)

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 82701-3-RR (CPT1B antibody) at dilution of 1:40000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 82701-3-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 82701-3-RR (same clone as 82701-3-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 82701-3-RR (CPT1B antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 82701-3-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 82701-3-RR (same clone as 82701-3-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 82701-3-RR (CPT1B antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 82701-3-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse heart using 82701-3-RR (same clone as 82701-3-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse heart tissue using CPT1B antibody (82701-3-RR, Clone: 242881B6 ) at dilution of 1:0 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 82701-3-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse heart using 82701-3-RR (same clone as 82701-3-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse heart tissue using CPT1B antibody (82701-3-RR, Clone: 242881B6 ) at dilution of 1:0 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 82701-3-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 82701-3-RR

  Biolayer interferometry (BLl) kinetic assays of 82701-3-RR against Human CPT1B were performed. The affinity constant is 5.70 nM.

CPT1B Uni-rAb^® Recombinant Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 82701-3-PBS

Clone No.242881B6

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

Carnitine O palmitoyltransferase 1, muscle isoform, Carnitine O-palmitoyltransferase 1, muscle isoform, Carnitine O-palmitoyltransferase I, muscle isoform, Carnitine palmitoyltransferase I-like protein, CPT1 M

---

Product Information

82701-3-PBS targets CPT1B in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag17840

  Product name: Recombinant human CPT1B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 110-250 aa of BC131570

  Sequence: FNTTRIPGKDTDVLQHLSDSRHVAVYHKGRFFKLWLYEGARLLKPQDLEMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAQARQAFFSSGKNKAALEAIERAAFFVALDEESYSYDPEDEASLSLYGKALLHGNCYNRWF

• Full Name: carnitine palmitoyltransferase 1B (muscle)
• Calculated Molecular Weight: 567 aa, 64 kDa
• Observed Molecular Weight: 70-85 kDa
• GenBank Accession Number: BC131570
• Gene Symbol: CPT1B
• Gene ID (NCBI): 1375
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q92523
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.