CPT2 Monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CPT2 Monoclonal antibody, PBS Only (68815-3-PBS)

CPT2 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 68815-3-PBS

Clone No.3F11C10

Host / Isotype

Mouse / IgG1

Reactivity

human, rat

Applications

WB, Indirect ELISA

Synonyms

Carnitine O-palmitoyltransferase 2, mitochondrial, carnitine palmitoyltransferase 2, CPT II, CPTASE, EC:2.3.1.21

• 

  WB analysis of rat liver using 68815-3-Ig (same clone as 68815-3-PBS)

  rat liver tissue were subjected to SDS PAGE followed by western blot with 68815-3-Ig (CPT2 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68815-3-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 68815-3-Ig (same clone as 68815-3-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68815-3-Ig (CPT2 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68815-3-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 68815-3-Ig (same clone as 68815-3-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68815-3-Ig (CPT2 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68815-3-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

68815-3-PBS targets CPT2 in WB, Indirect ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24833

  Product name: Recombinant human CPT2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 32-178 aa of BC002445

  Sequence: GQYLQRSIVPTMHYQDSLPRLPIPKLEDTIRRYLSAQKPLLNDGQFRKTEQFCKSFENGIGKELHEQLVALDKQNKHTSYILGPWFDMYLSARDSVVLNFNPFMAFNPDPKSEYNDQLTRATNMTVSAIRFLKTLRAGLLEPEVFHL

• Full Name: carnitine palmitoyltransferase 2
• Calculated Molecular Weight: 74 kDa
• Observed Molecular Weight: 65-70 kDa
• GenBank Accession Number: BC002445
• Gene Symbol: CPT2
• Gene ID (NCBI): 1376
• RRID: AB_3743315
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P23786
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Carnitine palmitoyltransferase-1 and -2 (CPT1 and CPT2) are two genetically distinct mitochondrial membrane bound enzymes and play critical role in the regulation of FAO in normal cells. CPT2 is an ubiquitous protein and locates in the inner membrane of mitochondrial (PMID: 29437870). CPT2 is frequently down-regulated in primary ovarian serous carcinomas, which is significantly correlated with poor survival of ovarian cancer patients (PMID: 33486313). Down-regulation of CPT2 was a major cause of acylcarnitine accumulation and a common feature in mouse models of obesity- and NASH-driven HCC and human SH-HCC (PMID: 29872321).