CPTP Polyclonal antibody

• 

  WB analysis using 33114-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33114-1-AP (CPTP antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

CPTP Polyclonal Antibody for WB, ELISA

Cat No. 33114-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

Ceramide-1-phosphate transfer protein, GLTP domain-containing protein 1, GLTPD1, Glycolipid transfer protein domain-containing protein 1

---

Tested Applications

• Positive WB detected in: Raji cells, Ramos cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33114-1-AP targets CPTP in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35748

  Product name: Recombinant human GLTPD1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-214 aa of NM_001029885

  Sequence: MDDSETGFNLKVVLVSFKQCLDEKEEVLLDPYIASWKGLVRFLNSLGTIFSFISKDVVSKLRIMERLRGGPQSEHYRSLQAMVAHELSNRLVDLERRSHHPESGCRTVLRLHRALHWLQLFLEGLRTSPEDARTSALCADSYNASLAAYHPWVVRRAVTVAFCTLPTREVFLEAMNVGPPEQAVQMLGEALPFIQRVYNVSQKLYAEHSLLDLP

• Full Name: glycolipid transfer protein domain containing 1
• Calculated Molecular Weight: 24 kDa，214aa
• Observed Molecular Weight: 24 kDa
• GenBank Accession Number: NM_001029885
• Gene Symbol: GLTPD1
• Gene ID (NCBI): 80772
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q5TA50
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Ceramide-1-phosphate transfer protein (CPTP) is a member of the glycolipid transfer protein (GLTP) family. It is the only identified protein in mammals that can selectively transport ceramide-1-phosphate (C1P) through a non-vesicular mechanism (PMID: 35982909). CPTP plays a crucial role in various biological processes, including cell proliferation, migration, and invasion. It is involved in the regulation of lipid metabolism, particularly in the context of ceramide-1-phosphate, which is a bioactive sphingolipid with roles in cell signaling, inflammation, and autophagy (PMID: 29164996).