CRB2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CRB2 Polyclonal antibody, PBS Only (28015-1-PBS)

• 

  IHC staining of mouse brain using 28015-1-AP (same clone as 28015-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 28015-1-AP (CRB2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28015-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse eye using 28015-1-AP (same clone as 28015-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse eye tissue using CRB2 antibody (28015-1-AP) at dilution of 1:200 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28015-1-PBS in a different storage buffer formulation.

CRB2 Polyclonal Antibody for IHC, IF-P, Indirect ELISA

Cat No. 28015-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF-P, Indirect ELISA

Synonyms

Crumbs homolog 2, crumbs homolog 2 (Drosophila), Crumbs like protein 2

---

Product Information

28015-1-PBS targets CRB2 in IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27826

  Product name: Recombinant human CRB2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 102-282 aa of NM_173689

  Sequence: MGPRCELDIDECASRPCHHGATCRNLADRYECHCPLGYAGVTCEMEVDECASAPCLHGGSCLDGVGSFRCVCAPGYGGTRCQLDLDECQSQPCAHGGTCHDLVNGFRCDCAGTGYEGTHCEREVLECASAPCEHNASCLEGLGSFRCLCWPGYSGELCEVDEDECASSPCQHGGRCLQRSDP

• Full Name: crumbs homolog 2 (Drosophila)
• Calculated Molecular Weight: 134 aa
• GenBank Accession Number: NM_173689
• Gene Symbol: CRB2
• Gene ID (NCBI): 286204
• RRID: AB_3669636
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5IJ48
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CRB2 (Crumbs homolog-2) has a large extracellular domain with epidermal growth-factor-like and laminin-A globular domains, a single transmembrane domain, and an intracellular C-terminal domain of 37 amino acids (PMID: 31438467). CRB2 is a candidate modifying gene of human CRB1-related retinal dystrophy (PMID: 24565864).