Filter:
Tested Applications
| Positive FC (Intra) detected in | Raji cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.50 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL555-14348 targets CRCP in FC (Intra) applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5689 Product name: Recombinant human CRCP protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-115 aa of BC040107 Sequence: MEVKDANSALLSNYETLKYISKTPCRHQSPEIVREFLTALKSHKLTKAEKLQLLNHRPVTAVEIQLMVEESEERLTEEQIEALLHTVTSILPAEPEAEQKKNTNSNVAMDEEDPA Predict reactive species |
| Full Name | CGRP receptor component |
| Calculated Molecular Weight | 17 kDa |
| Observed Molecular Weight | 20 kDa |
| GenBank Accession Number | BC040107 |
| Gene Symbol | CRCP |
| Gene ID (NCBI) | 27297 |
| RRID | AB_2919617 |
| Conjugate | CoraLite®555 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 557 nm / 570 nm |
| Form | Liquid |
| Purification Method | Antigen Affinity Purified |
| UNIPROT ID | O75575 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for CL555 CRCP antibody CL555-14348 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
