Tested Applications
Positive FC (Intra) detected in | Raji cells |
Recommended dilution
Application | Dilution |
---|---|
Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
CL488-14348 targets CRCP in FC (Intra) applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag5689 Product name: Recombinant human CRCP protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-115 aa of BC040107 Sequence: MEVKDANSALLSNYETLKYISKTPCRHQSPEIVREFLTALKSHKLTKAEKLQLLNHRPVTAVEIQLMVEESEERLTEEQIEALLHTVTSILPAEPEAEQKKNTNSNVAMDEEDPA Predict reactive species |
Full Name | CGRP receptor component |
Calculated Molecular Weight | 17 kDa |
Observed Molecular Weight | 20 kDa |
GenBank Accession Number | BC040107 |
Gene Symbol | CRCP |
Gene ID (NCBI) | 27297 |
RRID | AB_2919089 |
Conjugate | CoraLite® Plus 488 Fluorescent Dye |
Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
Form | Liquid |
Purification Method | Antigen Affinity Purified |
UNIPROT ID | O75575 |
Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Protocols
Product Specific Protocols | |
---|---|
FC protocol for CL Plus 488 CRCP antibody CL488-14348 | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |