CRCP Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CRCP Polyclonal antibody (14348-1-AP)

• KD/KO Validated

CRCP Polyclonal Antibody for WB, IHC, IF-P, FC (Intra), IP, ELISA

Cat No. 14348-1-AP Copied!

Publications (8)

Reviews (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, FC (Intra), IP, ELISA

Synonyms

Calcitonin gene-related peptide-receptor component protein, CGRP RCP, CGRP receptor component, CGRPRCP, CGRP-RCP

• 

  WB analysis of Raji using 14348-1-AP

  Raji cells were subjected to SDS PAGE followed by western blot with 14348-1-AP (CRCP antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Raji using 14348-1-AP

  WB result of CRCP antibody (14348-1-AP; 1:600; incubated at room temperature for 1.5 hours) with sh-Control and sh-CRCP transfected Raji cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of MCF-7 using 14348-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 14348-1-AP (CRCP antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 14348-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 14348-1-AP (CRCP antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human testis using 14348-1-AP

  human testis tissue were subjected to SDS PAGE followed by western blot with 14348-1-AP (CRCP antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of Raji using 14348-1-AP

  IP result of anti-CRCP (IP:14348-1-AP, 3ug; Detection:14348-1-AP 1:1000) with Raji cells lysate 2800ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 14348-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 14348-1-AP (CRCP Antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 14348-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 14348-1-AP (CRCP Antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse testis using 14348-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse testis tissue using CRCP antibody (14348-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of Raji using 14348-1-AP

  1x10^6 Raji cells were intracellularly stained with 0.25 ug CRCP Polyclonal antibody (14348-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug rabbit IgG isotype control (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CRCP in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: Raji cells, HeLa cells, human testis tissue, MCF-7 cells
• Positive IP detected in: Raji cells
• Positive IHC detected in: human testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse testis tissue
• Positive FC (Intra) detected in: Raji cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)-P: IF-P : 1:200-1:800
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14348-1-AP targets CRCP in WB, IHC, IF-P, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5689

  Product name: Recombinant human CRCP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-115 aa of BC040107

  Sequence: MEVKDANSALLSNYETLKYISKTPCRHQSPEIVREFLTALKSHKLTKAEKLQLLNHRPVTAVEIQLMVEESEERLTEEQIEALLHTVTSILPAEPEAEQKKNTNSNVAMDEEDPA

• Full Name: CGRP receptor component
• Calculated Molecular Weight: 17 kDa
• Observed Molecular Weight: 20 kDa
• GenBank Accession Number: BC040107
• Gene Symbol: CRCP
• Gene ID (NCBI): 27297
• RRID: AB_10641051
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O75575
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The CRCP Polyclonal antibody (Cat# 14348-1-AP) has 8 total citations. These appear in journals including Bioactive Materials, Journal of Neuroinflammation, Journal of Translational Medicine, CNS Neuroscience & Therapeutics, mSphere, Cell Biochemistry and Function, Journal of Immunology Research, and Neurogastroenterology & Motility. Research fields span bone regeneration, neuropathic pain and neuroinflammation, endometrial cancer/EMT, cell cycle regulation, neuronal growth, immune/inflammatory signaling, and visceral hyperalgesia.

Automatically generated from the 8 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	WB	Bioact Mater; Composite hydrogel-microsphere delivery system promotes early nerve-mediated bone regeneration and late-stage mechanotransduction-driven bone remodeling via sequential release of NGF and Yoda1.; Authors - Wei Chen
rat,mouse	IF	J Neuroinflammation; Calcitonin gene-related peptide regulates spinal microglial activation through the histone H3 lysine 27 trimethylation via enhancer of zeste homolog-2 in rats with neuropathic pain.; Authors - Qi An
human	WB	J Transl Med; CircESRP1 enhances metastasis and epithelial-mesenchymal transition in endometrial cancer via the miR-874-3p/CPEB4 axis.; Authors - Rui Shi
rat	WB,IF	CNS Neurosci Ther; Calcitonin gene-related peptide induces the histone H3 lysine 9 acetylation in astrocytes associated with neuroinflammation in rats with neuropathic pain.; Authors - Chenyan Sun
human	WB	mSphere; Genome-scale CRISPR/Cas9 screening reveals the role of PSMD4 in colibactin-mediated cell cycle arrest; Authors - Michael W Dougherty
rat	IF	Cell Biochem Funct; CNTs-CaP/chitosan-coated AZ91D magnesium alloy extract promoted rat dorsal root ganglia neuron growth via activating ERK signalling pathway.; Authors - Tingjiao Liu

Reviews

5.0 out of 5

1 verified customer reviews

What customers say

The product received a 5-star rating. The reviewer validated its performance across a broad range of applications, including Western Blot, Immunohistochemistry, Immunofluorescence, Immunoprecipitation, and Flow Cytometry, indicating reliable and consistent results in multiple experimental settings. No specific concerns or limitations were noted in the review.

Automatically generated from the 1 verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Temitope (Verified Customer) (09-05-2025)

• Applications: Western Blot, Immunohistochemistry, Immunofluorescence, Immunoprecipitation, Flow Cytometry