CRCP Polyclonal antibody

• 

  WB analysis of Raji using 14348-1-AP

  Raji cells were subjected to SDS PAGE followed by western blot with 14348-1-AP (CRCP antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MCF-7 using 14348-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 14348-1-AP (CRCP antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 14348-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 14348-1-AP (CRCP antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human testis using 14348-1-AP

  human testis tissue were subjected to SDS PAGE followed by western blot with 14348-1-AP (CRCP antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  IP experiment of Raji using 14348-1-AP

  IP result of anti-CRCP (IP:14348-1-AP, 3ug; Detection:14348-1-AP 1:1000) with Raji cells lysate 2800ug.

• 

  IHC staining of human testis using 14348-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 14348-1-AP (CRCP Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human testis using 14348-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 14348-1-AP (CRCP Antibody) at dilution of 1:50 (under 40x lens).

• 

  IF Staining of mouse testis using 14348-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse testis tissue using CRCP antibody (14348-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  FC experiment of Raji using 14348-1-AP

  1x10^6 Raji cells were intracellularly stained with 0.25 ug CRCP Polyclonal antibody (14348-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug rabbit IgG isotype control (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

CRCP Polyclonal Antibody for WB, IHC, IF-P, FC (Intra), IP, ELISA

Cat No. 14348-1-AP

Publications(7)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, FC (Intra), IP, ELISA

Synonyms

Calcitonin gene-related peptide-receptor component protein, CGRP RCP, CGRP receptor component, CGRPRCP, CGRP-RCP

---

Tested Applications

• Positive WB detected in: Raji cells, HeLa cells, human testis tissue, MCF-7 cells
• Positive IP detected in: Raji cells
• Positive IHC detected in: human testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse testis tissue
• Positive FC (Intra) detected in: Raji cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)-P: IF-P : 1:200-1:800
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 3 publications below
• IF: See 5 publications below

Product Information

14348-1-AP targets CRCP in WB, IHC, IF-P, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5689

  Product name: Recombinant human CRCP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-115 aa of BC040107

  Sequence: MEVKDANSALLSNYETLKYISKTPCRHQSPEIVREFLTALKSHKLTKAEKLQLLNHRPVTAVEIQLMVEESEERLTEEQIEALLHTVTSILPAEPEAEQKKNTNSNVAMDEEDPA

• Full Name: CGRP receptor component
• Calculated Molecular Weight: 17 kDa
• Observed Molecular Weight: 20 kDa
• GenBank Accession Number: BC040107
• Gene Symbol: CRCP
• Gene ID (NCBI): 27297
• RRID: AB_10641051
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O75575
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat,mouse	IF	J Neuroinflammation; Calcitonin gene-related peptide regulates spinal microglial activation through the histone H3 lysine 27 trimethylation via enhancer of zeste homolog-2 in rats with neuropathic pain.; Authors - Qi An
human	WB	mSphere; Genome-scale CRISPR/Cas9 screening reveals the role of PSMD4 in colibactin-mediated cell cycle arrest; Authors - Michael W Dougherty
human	WB	J Transl Med; CircESRP1 enhances metastasis and epithelial-mesenchymal transition in endometrial cancer via the miR-874-3p/CPEB4 axis.; Authors - Rui Shi
rat	WB,IF	CNS Neurosci Ther; Calcitonin gene-related peptide induces the histone H3 lysine 9 acetylation in astrocytes associated with neuroinflammation in rats with neuropathic pain.; Authors - Chenyan Sun
mouse	IF	Neurogastroenterol Motil; Altered gene expression signatures by calcitonin gene-related peptide promoted mast cell activity in the colon of stress-induced visceral hyperalgesia mice.; Authors - Hanliang Sun
rat	IF	Cell Biochem Funct; CNTs-CaP/chitosan-coated AZ91D magnesium alloy extract promoted rat dorsal root ganglia neuron growth via activating ERK signalling pathway.; Authors - Tingjiao Liu

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Temitope (Verified Customer) (09-05-2025)

• Applications: Western Blot, Immunohistochemistry, Immunofluorescence, Immunoprecipitation, Flow Cytometry