Tested Applications
| Positive WB detected in | mouse kidney tissue, mouse liver tissue, mouse ovary tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
19070-1-AP targets CREBZF in WB, IF, IHC, ELISA applications and shows reactivity with mouse samples.
| Tested Reactivity | mouse |
| Cited Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag13625 Product name: Recombinant human CREBZF protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 185-301 aa of BC093796 Sequence: GLAAENQELRAENRELGKRVQALQEESRYLRAVLANETGLARLLSRLSGVGLRLTTSLFRDSPAGDHDYALPVGKQKQDLLEEDDSAGGVCLHVDKDKVSVEFCSACARKASSSLKM Predict reactive species |
| Full Name | CREB/ATF bZIP transcription factor |
| Calculated Molecular Weight | 272 aa, 30 kDa |
| Observed Molecular Weight | 30 kDa |
| GenBank Accession Number | BC093796 |
| Gene Symbol | CREBZF |
| Gene ID (NCBI) | 58487 |
| RRID | AB_10641036 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NS37 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CREBZF is a basic region-leucine zipper (bZIP) transcription factor that belongs to the cAMP-response-element-binding protein (CREB)/activating transcription factor (ATF) family. CREBZF gene expression produces two isoforms, CREBZF-L (long isoform of CREBZF, also known as SMILE) and CREBZF-S (short isoform of CREBZF, also known as Zhangfei), resulting from alternative initiation codons. CREBZF fulfills its role in transcriptional regulation by heterodimerizing with other transcription factors as a coregulator and then binding to target promoters and regulating downstream gene expression. CREBZF has been identified as a novel transcriptional coregulator of a variety of nuclear receptors (PMID: 31124138).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for CREBZF antibody 19070-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The CREBZF Polyclonal antibody (Cat# 19070-1-AP) has 1 total citation. The cited publication appeared in FASEB Journal (2024), studying how cell-specific CREBZF deficiency affects adrenal cortex steroid secretion and behavioral abnormalities in adult male mice. The research field encompasses endocrinology, adrenal steroidogenesis, and neurobehavioral phenotyping. The antibody was applied in IHC and IF on mouse tissue from knockout models.
| Species | Application | Title |
|---|---|---|
FASEB J Androgen synthesis cell-specific CREBZF deficiency alters adrenal cortex steroid secretion and develops behavioral abnormalities in adult male mice
|
