CRELD2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CRELD2 Polyclonal antibody (27017-1-AP)

CRELD2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 27017-1-AP Copied!

Publications (3)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

CRELD2

• 

  WB analysis of human placenta using 27017-1-AP

  human placenta tissue were subjected to SDS PAGE followed by western blot with 27017-1-AP (CRELD2 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of SH-SY5Y using 27017-1-AP

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 27017-1-AP (CRELD2 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of U2OS using 27017-1-AP

  U2OS cells were subjected to SDS PAGE followed by western blot with 27017-1-AP (CRELD2 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human placenta using 27017-1-AP

  human placenta tissue were subjected to SDS PAGE followed by western blot with 27017-1-AP (CRELD2 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 27017-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 27017-1-AP (CRELD2 Antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 27017-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 27017-1-AP (CRELD2 Antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas using 27017-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas tissue slide using 27017-1-AP (CRELD2 Antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas using 27017-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas tissue slide using 27017-1-AP (CRELD2 Antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CRELD2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: human placenta tissue, SH-SY5Y cells, U2OS cells
• Positive IHC detected in: human placenta tissue, human pancreas tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27017-1-AP targets CRELD2 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25553

  Product name: Recombinant human CRELD2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 91-226 aa of BC050675

  Sequence: NQMLEAQEEHLEAWWLQLKSEYPDLFEWFCVKTLKVCCSPGTYGPDCLACQGGSQRPCSGNGHCSGDGSRQGDGSCRCHMGYQGPLCTDCMDGYFSSLRNETHSICTACDESCKTCSGLTNRDCGECEVGWVLDEG

• Full Name: cysteine-rich with EGF-like domains 2
• Calculated Molecular Weight: 44 kDa
• Observed Molecular Weight: 30-45 kDa
• GenBank Accession Number: BC050675
• Gene Symbol: CRELD2
• Gene ID (NCBI): 79174
• RRID: AB_2880723
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6UXH1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The CRELD2 Polyclonal antibody (Cat# 27017-1-AP) has 3 total citations. These appear in Molecular Therapy, Stem Cell Research & Therapy, and Inflammation Research. The associated research fields include hepatocellular carcinoma, angiogenesis coupled with osteogenesis via the PERK-ATF4-CRELD2 pathway, and clear cell renal cell carcinoma (ccRCC) involving integrative omics profiling of CRELD2 in tumor microenvironment and prognosis.

Automatically generated from the 3 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Mol Ther; Ectopic clotting factor VIII expression and misfolding in hepatocytes as a cause for hepatocellular carcinoma; Authors - Audrey Kapelanski-Lamoureux
human	WB	Stem Cell Res Ther; Endothelial cell-secreted bone targeting exosomes promote angiogenesis coupling with osteogenesis via the PERK-ATF4-CRELD2 pathway; Authors - Zhilong Pi
		Inflamm Res; Integrative omics profiling of CRELD2 in ccRCC: a nexus of genetics, prognosis, and tumor microenvironment.; Authors - Shouyong Liu