CRH Recombinant monoclonal antibody, PBS Only (Detector)

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• CRH Recombinant monoclonal antibody, PBS Only (Detector) (86571-2-PBS)

CRH Uni-rAb^® Recombinant Antibody for Sandwich ELISA, Indirect ELISA

Cat No. 86571-2-PBS

Clone No.251310E10

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Sandwich ELISA, Indirect ELISA

Synonyms

Corticoliberin, Corticotropin releasing factor, Corticotropin-releasing factor, Corticotropin-releasing hormone, CRF

• 

  Sandwich ELISA sample test of MP02703-1

  Plasma of sixteen individual healthy human donors was measured. The human CRH/CRF concentration of detected samples was determined to be 86.5 pg/mL with a range of 20.6-503.0 pg/mL.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Sandwich ELISA sample test of MP02703-1

  Serum of nine individual healthy human donors was measured. The human CRH/CRF concentration of detected samples was determined to be 71.0 pg/mL with a range of 16.3-215.7 pg/mL.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Sandwich ELISA standard curve of MP02703-1

  Sandwich ELISA standard curve of MP02703-1, Human CRH/CRF Recombinant Matched Antibody Pair - PBS only. 86571-3-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Eg4974. 86571-2-PBS was HRP conjugated as the detection antibody. Range: 15.6-1000 pg/mL

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity of 86571-2-PBS

  Biolayer interferometry (BLl) kinetic assay of 86571-2-PBS against Human CRH was performed. The affinity constant is 0.213 nM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

86571-2-PBS targets CRH as part of a matched antibody pair:

MP02703-1: 86571-3-PBS capture and 86571-2-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg4974

  Product name: Recombinant Human CRH/CRF protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 25-194 aa of BC011031

  Sequence: LLSRGPVPGARQAPQHPQPLDFFQPPPQSEQPQQPQARPVLLRMGEEYFLRLGNLNKSPAAPLSPASSLLAGGSGSRPSPEQATANFFRVLLQQLLLPRRSLDSPAALAERGARNALGGHQEAPERERRSEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII

• Full Name: CRH/CRF
• Calculated Molecular Weight: 21 kDa
• GenBank Accession Number: BC011031
• Gene Symbol: CRH
• Gene ID (NCBI): 1392
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P06850
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.