CRHBP Polyclonal antibody

• 

CRHBP Polyclonal Antibody for ELISA

Cat No. 12443-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

ELISA

Synonyms

CRF binding protein, CRF BP, CRFBP, CRH BP, CRHBP

---

Product Information

12443-1-AP targets CRHBP in ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3154

  Product name: Recombinant human CRHBP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-322 aa of BC018038

  Sequence: MSPNFKLQCHFILIFLTALRGESRYLELREAADYDPFLLFSANLKRELAGEQPYRRALRCLDMLSLQGQFTFTADRPQLHCAAFFISEPEEFITIHYDQVSIDCQGGDFLKVFDGWILKGEKFPSSQDHPLPSAERYIDFCESGLSRRSIRSSQNVAMIFFRVHEPGNGFTLTIKTDPNLFPCNVISQTPNGKFTLVVPHQHRNCSFSIIYPVVIKISDLTLGHVNGLQLKKSSAGCEGIGDFVELLGGTGLDPSKMTPLADLCYPFHGPAQMKVGCDNTVVRMVSSGKHVNRVTFEYRQLEPYELENPNGNSIGEFCLSGL

• Full Name: corticotropin releasing hormone binding protein
• Calculated Molecular Weight: 322 aa, 36 kDa
• GenBank Accession Number: BC018038
• Gene Symbol: CRHBP
• Gene ID (NCBI): 1393
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P24387
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.