CRIP2 Polyclonal antibody

• 

  WB analysis of mouse heart using 14801-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 14801-1-AP (CRIP2 Antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse lung using 14801-1-AP

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 14801-1-AP (CRIP2 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 14801-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 14801-1-AP (CRIP2 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 14801-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 14801-1-AP (CRIP2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MCF-7 using 14801-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 14801-1-AP (CRIP2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HeLa using 14801-1-AP

  Immunofluorescent analysis of HeLa cells using 14801-1-AP (CRIP2 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of HeLa using 14801-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using CRIP2 antibody (14801-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

CRIP2 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 14801-1-AP

Publications(2)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IF/ICC, IP, ELISA

Synonyms

CRIP, CRIP 2, CRP 2, CRP2, CRP-2

---

Tested Applications

• Positive WB detected in: mouse heart tissue, HeLa cells, MCF-7 cells, mouse brain tissue, mouse lung tissue
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 2 publications below
• IF: See 2 publications below
• IP: See 1 publications below

Product Information

14801-1-AP targets CRIP2 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, rat, zebrafish
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6515

  Product name: Recombinant human CRIP2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-208 aa of BC000434

  Sequence: MASKCPKCDKTVYFAEKVSSLGKDWHKFCLKCERCSKTLTPGGHAEHDGKPFCHKPCYATLFGPKGVNIGGAGSYIYEKPLAEGPQVTGPIEVPAARAEERKASGPPKGPSRASSVTTFTGEPNTCPRCSKKVYFAEKVTSLGKDWHRPCLRCERCGKTLTPGGHAEHDGQPYCHKPCYGILFGPKGVNTGAVGSYIYDRDPEGKVQP

• Full Name: cysteine-rich protein 2
• Calculated Molecular Weight: 22 kDa
• Observed Molecular Weight: 23-29 kDa
• GenBank Accession Number: BC000434
• Gene Symbol: CRIP2
• Gene ID (NCBI): 1397
• RRID: AB_2245316
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P52943
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CRIP2, also known as CRP2 and ESP1, belongs to the cysteine-rich intestinal protein family (CRIP family). The CRIP family is a subfamily of the highly conserved Lin-1, Isl1, Mec3/double zinc finger protein family that exhibits diverse biological functions. CRIP2 is a cardiac vascular marker, and its expression is detected in cardiac endothelial cells during development and in the adult heart(PMID: 40118853).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	WB,IP,IF	Basic Res Cardiol; Alkaline nucleoplasm facilitates contractile gene expression in the mammalian heart.; Authors - Alzbeta Hulikova
zebrafish,human	WB,IF	Cell Mol Life Sci; Crip2 affects vascular development by fine-tuning endothelial cell aggregation and proliferation; Authors - Shuaiqi Yang ; KD Validated

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Joleen (Verified Customer) (06-07-2019)

The CRIP2 antibody works well and the protein shows up prominently as the lower band.

• Applications: Western Blot,
• Primary Antibody Dilution: 1:1k
• Cell Tissue Type: MDCK GII

CRIP2 Antibody Western Blot, validation (1:1k dilution) in MDCK GII (Cat no:14801-1-AP)