CRISP2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CRISP2 Polyclonal antibody (19066-1-AP)

• Featured Product
• KD/KO Validated

CRISP2 Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 19066-1-AP Copied!

Publications (10)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF, IP, ELISA

Synonyms

Cancer/testis antigen 36, CRISP 2, CRISP2, CT36, GAPDL5, Testis specific protein TPX 1, TPX1, TSP1

• 

  WB analysis using 19066-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 19066-1-AP (CRISP2 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human testis using 19066-1-AP

  human testis tissue were subjected to SDS PAGE followed by western blot with 19066-1-AP (CRISP2 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human testis using 19066-1-AP

  human testis tissue were subjected to SDS PAGE followed by western blot with 19066-1-AP (CRISP2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse testis using 19066-1-AP

  IP result of anti-CRISP2 (IP:19066-1-AP, 4ug; Detection:19066-1-AP 1:300) with mouse testis tissue lysate 4000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 19066-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis using 19066-1-AP (CRISP2 antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 19066-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis using 19066-1-AP (CRISP2 antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CRISP2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse testis tissue, human testis tissue, rat testis tissue
• Positive IP detected in: mouse testis tissue
• Positive IHC detected in: human testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

19066-1-AP targets CRISP2 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13574

  Product name: Recombinant human CRISP2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 27-243 aa of BC022011

  Sequence: TALLTTQLQVQREIVNKHNELRKAVSPPASNMLKMEWSREVTTNAQRWANKCTLQHSDPEDRKTSTRCGENLYMSSDPTSWSSAIQSWYDEILDFVYGVGPKSPNAVVGHYTQLVWYSTYQVGCGIAYCPNQDSLKYYYVCQYCPAGNNMNRKNTPYQQGTPCAGCPDDCDKGLCTNSCQYQDLLSNCDSLKNTAGCEHELLKEKCKATCLCENKIY

• Full Name: cysteine-rich secretory protein 2
• Calculated Molecular Weight: 27 kDa
• Observed Molecular Weight: 27 kDa
• GenBank Accession Number: BC022011
• Gene Symbol: CRISP2
• Gene ID (NCBI): 7180
• RRID: AB_10667008
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P16562
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The anti-CRISP2 antibody (Cat# 19066-1-AP) has 10 total citations published in journals including Nature, Nature Communications, Nucleic Acids Research, FASEB Journal, Molecular Human Reproduction, Biology of Reproduction, Asian Journal of Andrology, and Journal of Animal Science and Biotechnology. Research fields span male reproductive biology, spermatogenesis, sperm structure and function, piRNA biogenesis, transcript splicing regulation, reproductive toxicity, and male infertility disorders such as asthenozoospermia.

Automatically generated from the 10 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Nature; A male germ-cell-specific ribosome controls male fertility; Authors - Huiling Li
mouse	IF	Nat Commun; PNLDC1 is essential for piRNA 3' end trimming and transposon silencing during spermatogenesis in mice.; Authors - Deqiang Ding
mouse	WB	Nucleic Acids Res; DAZAP1 regulates the splicing of Crem, Crisp2 and Pot1a transcripts.; Authors - Chen Hsiang-Ying HY
mouse	IF	J Anim Sci Biotechnol; Single-cell transcriptomics reveals the cellular dynamics of hexafluoropropylene oxide dimer acid in exerting mouse male reproductive toxicity; Authors - Xupeng Zang
mouse	WB	FASEB J; Functional redundancy and compensation: Deletion of multiple murine Crisp genes reveals their essential role for male fertility.; Authors - L Curci
mouse	WB	Mol Hum Reprod; Fertilization defects in sperm from Cysteine-rich secretory protein 2 (Crisp2) knockout mice: implications for fertility disorders.; Authors - N G Brukman ; KO Validated