CRK Polyclonal antibody

• 

  IHC staining of human prostate cancer using 10973-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer using 10973-1-AP (CRK antibody) at dilution of 1:50 (under 10x lens).

CRK Polyclonal Antibody for IHC, ELISA

Cat No. 10973-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, ELISA

Synonyms

Adapter molecule crk, CRK, CRKII, Proto oncogene c Crk

---

Product Information

10973-1-AP targets CRK in IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1420

  Product name: Recombinant human CRK protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 40-204 aa of BC009837

  Sequence: SSTSPGDYVLSVSENSRVSHYIINSSGPRPPVPPSPAQPPPGVSPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVSRSRQGSGVILRQEEAEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKYRPASASVSALIGGR

• Full Name: v-crk sarcoma virus CT10 oncogene homolog (avian)
• Calculated Molecular Weight: 40 kDa
• GenBank Accession Number: BC009837
• Gene Symbol: CRK
• Gene ID (NCBI): 1398
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P46108
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.