CRK Polyclonal antibody

• 

  WB analysis of NIH/3T3 using 16685-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 16685-1-AP (CRK Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of NIH/3T3 using 16685-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 16685-1-AP (CRK Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of PC-3 using 16685-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 16685-1-AP (CRK Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A549 using 16685-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 16685-1-AP (CRK Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human urothelial carcinoma using 16685-1-AP

  Immunohistochemical analysis of paraffin-embedded human urothelial carcinoma tissue slide using 16685-1-AP (CRK antibody) at dilution of 1:800 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human urothelial carcinoma using 16685-1-AP

  Immunohistochemical analysis of paraffin-embedded human urothelial carcinoma tissue slide using 16685-1-AP (CRK antibody) at dilution of 1:800 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 16685-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using 16685-1-AP (CRK antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of PC-3 using 16685-1-AP

  Immunofluorescent analysis of (-20℃ Ethanol) fixed PC-3 cells using 16685-1-AP (CRK antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

CRK Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 16685-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Adapter molecule crk, CRK, CRKII, p38, Proto oncogene c Crk

---

Tested Applications

• Positive WB detected in: NIH/3T3 cells, A549 cells, PC-3 cells
• Positive IHC detected in: human urothelial carcinoma tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells, PC-3 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:400-1:1600
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

16685-1-AP targets CRK in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10016

  Product name: Recombinant human CRK protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 41-304 aa of BC008506

  Sequence: STSPGDYVLSVSENSRVSHYIINSSGPRPPVPPSPAQPPPGVSPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVSRSRQGSGVILRQEEAEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKYRPASASVSALIGGNQEGSHPQPLGGPEPGPYAQPSVNTPLPNLQNGPIYARVIQKRVPNAYDKTALALEVGELVKVTKINVSGQWEGECNGKRGHFPFTHVRLLDQQNPDEDFS

• Full Name: v-crk sarcoma virus CT10 oncogene homolog (avian)
• Calculated Molecular Weight: 34 kDa
• Observed Molecular Weight: 34 kDa
• GenBank Accession Number: BC008506
• Gene Symbol: CRK
• Gene ID (NCBI): 1398
• RRID: AB_2084893
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P46108
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Commun; PPIA dictates NRF2 stability to promote lung cancer progression; Authors - Weiqiang Lu