CDK12/CRKRS Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86296-3-RR (same clone as 86296-3-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86296-3-RR (CDK12/CRKRS antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86296-3-PBS in a different storage buffer formulation.

• 

  WB analysis of NIH/3T3 using 86296-3-RR (same clone as 86296-3-PBS)

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 86296-3-RR (CDK12/CRKRS antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86296-3-PBS in a different storage buffer formulation.

• 

  IF Staining of NIH/3T3 using 86296-3-RR (same clone as 86296-3-PBS)

  Immunofluorescent analysis of (4% PFA) fixed NIH/3T3 cells using CDK12/CRKRS antibody (86296-3-RR, Clone: 250880E5 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 86296-3-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 86296-3-RR (same clone as 86296-3-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using CDK12/CRKRS antibody (86296-3-RR, Clone: 250880E5 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 86296-3-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 86296-3-RR

  Biolayer interferometry (BLl) kinetic assays of 86296-3-RR against Human CDK12/CRKRS were performed. The affinity constant is 0.106 nM.

CDK12/CRKRS Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 86296-3-PBS

Clone No.250880E5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

CrkRS, CDC2 related protein kinase 7, Cdc2-related kinase, arginine/serine-rich, CDC2-related protein kinase 7, CDK12

---

Product Information

86296-3-PBS targets CDK12/CRKRS in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag25312

  Product name: Recombinant human CRKRS protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1300-1481 aa of BC150265

  Sequence: EAEPPGHLPHEHQALRPMEYSTRPRPNRTYGNTDGPETGFSAIDTDERNSGPALTESLVQTLVKNRTFSGSLSHLGESSSYQGTGSVQFPGDQDLRFARVPLALHPVVGQPFLKAEGSSNSVVHAETKLQNYGELGPGTTGASSSGAGLHWGGPTQSSAYGKLYRGPTRVPPRGGRGRGVPY

• Full Name: Cdc2-related kinase, arginine/serine-rich
• Calculated Molecular Weight: 1490 aa, 164 kDa
• Observed Molecular Weight: 180-200 kDa
• GenBank Accession Number: BC150265
• Gene Symbol: CDK12
• Gene ID (NCBI): 51755
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9NYV4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CRKRS (Cdc2-related kinase, Arg/Ser), also named as cyclin-dependent kinase 12 (CKD12), belongs to CDC2/CDKX subfamily. CDK12 can form a heterodimeric complex with its activating partner, cyclin K, to regulate important cellular physiological processes that include transcriptional regulation, regulation of DNA damage repair genes such as BRCA1 and ATM, suppression of intronic polyadenylation, and susceptibility to PARP inhibitors (PMID: 30487607, 24240700, 31694772). CDK12 has 3 isoforms with the calculated molecular mass of 164/163/141 kDa, and the apparent molecular mass of 180-200 kDa due to some modifications (PMID 11683387, 22988298).