CRLF2 Polyclonal antibody

• 

  WB analysis using 28365-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28365-1-AP (CRLF2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 28365-1-AP

  WB result of CRLF2 antibody (28365-1-AP; 1:600; incubated at room temperature for 1.5 hours) with sh-Control and sh-CRLF2 transfected HepG2 cells.

• KD/KO Validated

CRLF2 Polyclonal Antibody for WB, ELISA

Cat No. 28365-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

CRL2, CRLF2Y, IL XR, ILXR, TSLP receptor

---

Tested Applications

• Positive WB detected in: HepG2 cells, Jurkat cells, L02 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

28365-1-AP targets CRLF2 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26842

  Product name: Recombinant human CRLF2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 24-123 aa of NM_001012288

  Sequence: MGGAAEGVQIQIIYFNLETVQVTWNASKYSRTNLTFHYRFNGDEAYDQCTNYLLQEGHTSGCLLDAEQRDDILYFSIRNGTHPVFTASRWMVYYLKPSSPK

• Full Name: cytokine receptor-like factor 2
• Calculated Molecular Weight: 42 kDa
• Observed Molecular Weight: 42 kDa
• GenBank Accession Number: NM_001012288
• Gene Symbol: CRLF2
• Gene ID (NCBI): 64109
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9HC73
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cytokine receptor-like factor 2 (CRLF2), also known as the thymic stromal derived lymphopoietin receptor (TSLPR), which in combination with the interleukin 7 receptor a chain (IL-7R) forms the receptor for thymic stromal lymphopoietin. CRLF2 is a type I cytokine receptor. CRLF2 rearrangements occur either as a translocation to the immunoglobulin heavy-chain enhancer region (IGH-CRLF2) or by a deletion of upstream PAR1 that leads to joining of CRLF2 to adjacent P2RY8. CRLF2 is expressed in heart, skeletal muscle, kidney and adult and fetal liver and is primarily expressed in dendrites and monocytes. (PMID: 20807819; 31644323; 33485429)