• Featured Product
  • KD/KO Validated

CoraLite®594-conjugated C-Reactive Protein/CRP Monoclonal antibody

C-Reactive Protein/CRP Monoclonal Antibody for IF-P
Cat No. CL594-66250
Clone No.3F10A11

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat, pig

Applications

IF-P

CRP, PTX1, C-reactive protein(1-205), C-Reactive Protein, C reactive protein

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inhuman liver tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-66250 targets C-Reactive Protein/CRP in IF-P applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag9883

Product name: Recombinant human CRP protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-91 aa of BC020766

Sequence: MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTELSSTRGPNVLNWRALKYEVQGEVFTKPQLWP

Predict reactive species
Full Name C-reactive protein, pentraxin-related
Calculated Molecular Weight 224 aa, 25 kDa
Observed Molecular Weight 27 kDa
GenBank Accession NumberBC020766
Gene Symbol CRP
Gene ID (NCBI) 1401
RRIDAB_2883544
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
Excitation LaserYellow-Green Laser (561 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP02741
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

C-reactive protein (CRP) is an acute-phase serum protein synthesized by the liver in response to interleukin-6 (IL-6) during inflammation. The name of CRP derives from its ability to react with the C polysaccharide of Streptococcus pneumoniae. CRP is an annular, pentameric protein that belongs to the pentraxin family of proteins. CRP displays several functions associated with host defense: it promotes agglutination, bacterial capsular swelling, phagocytosis and complement fixation through its calcium-dependent binding to phosphorylcholine. It is used mainly as a marker of inflammation.

Protocols

Product Specific Protocols
IF protocol for CL594 C-Reactive Protein/CRP antibody CL594-66250Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...