CRTAC1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CRTAC1 Polyclonal antibody (13001-1-AP)

CRTAC1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 13001-1-AP Copied!

Publications (6)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

Synonyms

68 kDa chondrocyte-expressed protein, ASPIC, ASPIC1, Cartilage acidic protein 1, CEP 68

• 

  WB analysis of human brain using 13001-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 13001-1-AP (CRTAC1 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse lung using 13001-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 13001-1-AP (CRTAC1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse lung using 13001-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 13001-1-AP (CRTAC1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 13001-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 13001-1-AP (CRTAC1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat lung using 13001-1-AP

  Immunohistochemical analysis of paraffin-embedded rat lung tissue slide using 13001-1-AP (CRTAC1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CRTAC1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: human brain tissue
• Positive IHC detected in: mouse lung tissue, mouse brain tissue, rat lung tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13001-1-AP targets CRTAC1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3673

  Product name: Recombinant human CRTAC1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 99-451 aa of BC034245

  Sequence: VYGNWNGPHRLYLQMSTHGKVRFRDIASPKFSMPSPVRTVITADFDNDQELEIFFNNIAYRSSSANRLFRVIRREHGDPLIEELNPGDALEPEGRGTGGVVTDFDGDGMLDLILSHGESMAQPLSVFRGNQGFNNNWLRVVPRTRFGAFARGAKVVLYTKKSGAHLRIIDGGSGYLCEMEPVAHFGLGKDEASSVEVTWPDGKMVSRNVASGEMNSVLEILYPRDEDTLQDPAPLECGQGFSQQENGHCMDTNECIQFPFVCPRDKPVCVNTYGSYRCRTNKKCSRGYEPNEDGTACVGTLGQSPGPRPTTPTAAAATAAAAAAAGAATAAPVLVDGDLNLGSVVKESCEPSC

• Full Name: cartilage acidic protein 1
• Calculated Molecular Weight: 661 aa, 71 kDa
• Observed Molecular Weight: 68-72 kDa
• GenBank Accession Number: BC034245
• Gene Symbol: CRTAC1
• Gene ID (NCBI): 55118
• RRID: AB_10638787
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NQ79
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The CRTAC1 Polyclonal antibody (Cat# 13001-1-AP) has 6 citations published in J Transl Med, Cell Reports, Scientific Reports, Molecular Oncology, American Journal of Rhinology & Allergy, and Research Square. Research fields span pancreatic cancer risk assessment, atherosclerosis vascular biology, lung adenocarcinoma biomarkers, glioblastoma proteomics, chronic rhinosinusitis proteome analysis, and ocular limbus epithelial biology. Applications cited include IHC, WB, and IF in human samples.

Automatically generated from the 6 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	J Transl Med; Machine learning-based clinical prediction model and multi-omics integration for assessing pancreatic cancer risk in new-onset diabetes.; Authors - Jiabin Yang
human	IF	Cell Rep; Integrative single-cell meta-analysis reveals disease-relevant vascular cell states and markers in human atherosclerosis; Authors - Jose Verdezoto Mosquera
human	WB,IHC	Sci Rep; CRTAC1 identified as a promising diagnosis and prognostic biomarker in lung adenocarcinoma; Authors - Lin Tan
	IHC	Mol Oncol; A DIA-MS-based proteomics approach to find potential serum prognostic biomarkers in glioblastoma patients; Authors - Anne Clavreul
human	WB	Am J Rhinol Allergy; Analysis of CRSsNP Proteome Using a Highly Multiplexed Approach in Nasal Mucus; Authors - Vanessa-Vivien Pesold
		Res Sq; The human limbus functions as an instructive epithelial transition zone.; Authors - Natasha Frank