CRTAC1 Polyclonal antibody

• 

  WB analysis of human brain using 13001-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 13001-1-AP (CRTAC1 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse lung using 13001-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 13001-1-AP (CRTAC1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse lung using 13001-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 13001-1-AP (CRTAC1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 13001-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 13001-1-AP (CRTAC1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat lung using 13001-1-AP

  Immunohistochemical analysis of paraffin-embedded rat lung tissue slide using 13001-1-AP (CRTAC1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

CRTAC1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 13001-1-AP

Publications(4)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

Synonyms

ASPIC, ASPIC1, cartilage acidic protein 1, CEP 68, CEP68, CRTAC1

---

Tested Applications

• Positive WB detected in: human brain tissue
• Positive IHC detected in: mouse lung tissue, mouse brain tissue, rat lung tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• IHC: See 2 publications below
• IF: See 1 publications below

Product Information

13001-1-AP targets CRTAC1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3673

  Product name: Recombinant human CRTAC1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 99-451 aa of BC034245

  Sequence: VYGNWNGPHRLYLQMSTHGKVRFRDIASPKFSMPSPVRTVITADFDNDQELEIFFNNIAYRSSSANRLFRVIRREHGDPLIEELNPGDALEPEGRGTGGVVTDFDGDGMLDLILSHGESMAQPLSVFRGNQGFNNNWLRVVPRTRFGAFARGAKVVLYTKKSGAHLRIIDGGSGYLCEMEPVAHFGLGKDEASSVEVTWPDGKMVSRNVASGEMNSVLEILYPRDEDTLQDPAPLECGQGFSQQENGHCMDTNECIQFPFVCPRDKPVCVNTYGSYRCRTNKKCSRGYEPNEDGTACVGTLGQSPGPRPTTPTAAAATAAAAAAAGAATAAPVLVDGDLNLGSVVKESCEPSC

• Full Name: cartilage acidic protein 1
• Calculated Molecular Weight: 661 aa, 71 kDa
• Observed Molecular Weight: 68-72 kDa
• GenBank Accession Number: BC034245
• Gene Symbol: CRTAC1
• Gene ID (NCBI): 55118
• RRID: AB_10638787
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NQ79
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Cell Rep; Integrative single-cell meta-analysis reveals disease-relevant vascular cell states and markers in human atherosclerosis; Authors - Jose Verdezoto Mosquera
human	WB,IHC	Sci Rep; CRTAC1 identified as a promising diagnosis and prognostic biomarker in lung adenocarcinoma; Authors - Lin Tan
	IHC	Mol Oncol; A DIA-MS-based proteomics approach to find potential serum prognostic biomarkers in glioblastoma patients; Authors - Anne Clavreul
human	WB	Am J Rhinol Allergy; Analysis of CRSsNP Proteome Using a Highly Multiplexed Approach in Nasal Mucus; Authors - Vanessa-Vivien Pesold