CRTAC1 Polyclonal antibody

• 

  WB analysis using 30251-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30251-1-AP (CRTAC1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 30251-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30251-1-AP (CRTAC1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse brain using 30251-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 30251-1-AP (CRTAC1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat brain using 30251-1-AP

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 30251-1-AP (CRTAC1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

CRTAC1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 30251-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

ASPIC, ASPIC1, cartilage acidic protein 1, CEP 68, CEP68, CRTAC1, FLJ10320

---

Tested Applications

• Positive WB detected in: human plasma, mouse brain tissue, rat brain tissue
• Positive IHC detected in: mouse brain tissue, rat brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

30251-1-AP targets CRTAC1 in WB, IHC, ELISA applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Cited Reactivity: rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag32963

  Product name: Recombinant human CRTAC1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 198-332 aa of BC034245

  Sequence: VVTDFDGDGMLDLILSHGESMAQPLSVFRGNQGFNNNWLRVVPRTRFGAFARGAKVVLYTKKSGAHLRIIDGGSGYLCEMEPVAHFGLGKDEASSVEVTWPDGKMVSRNVASGEMNSVLEILYPRDEDTLQDPAP

• Full Name: cartilage acidic protein 1
• Calculated Molecular Weight: 661 aa, 71 kDa
• Observed Molecular Weight: 71-100 kDa
• GenBank Accession Number: BC034245
• Gene Symbol: CRTAC1
• Gene ID (NCBI): 55118
• RRID: AB_3086281
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NQ79
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CRTAC1 (Cartilage acidic protein 1) is also named as ASPIC and 68 kDa chondrocyte-expressed protein (CEP-68). Cartilage acidic protein 1 (CRTAC1), a novel human marker which allowed discrimination of human chondrocytes from osteoblasts and mesenchymal stem cells (PMID: 17074475). CRTAC1 is a glycosylated calcium-binding extracellular matrix protein (PMID: 37796703). CRTAC1 acquired an alternate last exon from the tail-to-tail oriented neighbouring gene in humans resulting in the glycosylated isoform CRTAC1-A which represents a new extracellular matrix molecule of articular cartilage (PMID: 17074475). CRTAC1 was downregulated in bladder cancer tissues and cells (PMID: 34818994).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	WB	Int J Mol Sci; Identification of Thyroid Genes Whose Expression Is Altered by Neonatal Irradiation in Rats; Authors - Nariaki Fujimoto