CRTAC1 Monoclonal antibody, PBS Only

CRTAC1 Monoclonal Antibody for WB, IF/ICC, Indirect ELISA
Cat No. 68276-1-PBS
Clone No.2A11E2

Host / Isotype

Mouse / IgG2b

Reactivity

Human, rat, mouse, rabbit, pig

Applications

WB, IF/ICC, Indirect ELISA

ASPIC, ASPIC1, cartilage acidic protein 1, CEP 68, CEP68, CRTAC1, FLJ10320

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68276-1-PBS targets CRTAC1 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with Human, rat, mouse, rabbit, pig samples.

Tested Reactivity Human, rat, mouse, rabbit, pig
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag32813

Product name: Recombinant human CRTAC1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 99-451 aa of BC034245

Sequence: VYGNWNGPHRLYLQMSTHGKVRFRDIASPKFSMPSPVRTVITADFDNDQELEIFFNNIAYRSSSANRLFRVIRREHGDPLIEELNPGDALEPEGRGTGGVVTDFDGDGMLDLILSHGESMAQPLSVFRGNQGFNNNWLRVVPRTRFGAFARGAKVVLYTKKSGAHLRIIDGGSGYLCEMEPVAHFGLGKDEASSVEVTWPDGKMVSRNVASGEMNSVLEILYPRDEDTLQDPAPLECGQGFSQQENGHCMDTNECIQFPFVCPRDKPVCVNTYGSYRCRTNKKCSRGYEPNEDGTACVGTLGQSPGPRPTTPTAAAATAAAAAAAGAATAAPVLVDGDLNLGSVVKESCEPSC

Predict reactive species
Full Name cartilage acidic protein 1
Calculated Molecular Weight 661 aa, 71 kDa
Observed Molecular Weight 71 kDa
GenBank Accession NumberBC034245
Gene Symbol CRTAC1
Gene ID (NCBI) 55118
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9NQ79
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

CRTAC1 (cartilage acidic protein 1) is also named as ASPIC1 and CEP68. CRTAC1 is an extracellular matrix protein of human chondrogenic tissue. CRTAC1 promotes cell proliferation, migration and extracellular matrix regeneration and remodeling in primary human fibroblasts (PMID:32084494). CRTAC1 expression is decreased in tissue samples of bladder urothelial carcinoma (PMID:34818994). CRTAC1 overexpression promotes the pyroptosis of human lens epithelial cells by facilitating the reactive oxygen species (ROS) production in the formation of cataract (PMID:32838966). CRTAC1 was the most compelling and robust biomarker for osteoarthritis severity and progression (PMID:35924962).

Loading...
||
New chat Able
正在加载,请稍候...