Cryptochrome 1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 83602-5-RR (same clone as 83602-5-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83602-5-RR (CRY1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83602-5-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83602-5-RR

  Biolayer interferometry (BLl) kinetic assays of 83602-5-RR against Human Cryptochrome 1 were performed. The affinity constant is below 1 pM.

Cryptochrome 1 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 83602-5-PBS

Clone No.240520B12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

CRY1, Cryptochrome-1, CRY 1, 240520B12

---

Product Information

83602-5-PBS targets Cryptochrome 1 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag4270

  Product name: Recombinant human CRY1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 236-586 aa of BC030519

  Sequence: RPRMNANSLLASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLLWREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFHCYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMVNHAEASRLNIERMKQIYQQLSRYRGLGLLASVPSNPNGNGGFMGYSAENIPGCSSSGSCSQGSGILHYAHGDSQQTHLLKQGRSSMGTGLSGGKRPSQEEDTQSIGPKVQRQSTN

• Full Name: cryptochrome 1 (photolyase-like)
• Calculated Molecular Weight: 586 aa, 66 kDa
• Observed Molecular Weight: 60-66 kDa
• GenBank Accession Number: BC030519
• Gene Symbol: CRY1
• Gene ID (NCBI): 1407
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q16526
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Cryptochrome circadian clock 1 (CRY1) is a flavin adenine dinucleotide-binding protein with MW of 66 kDa. CRY1 is a key component of the circadian core oscillator complex, which regulates the circadian clock. CRY1 predominantly displays evening-time expression and serves as a strong repressor of morning-time elements (E box/E-prime box) when bound to the BMAL1 (ARNTL; 602550)/CLOCK (601851) complex (PubMed: 21236481).