CRYGN Polyclonal antibody

• 

  WB analysis of mouse eye using 21281-1-AP

  mouse eye tissue were subjected to SDS PAGE followed by western blot with 21281-1-AP (CRYGN Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

CRYGN Polyclonal Antibody for WB, ELISA

Cat No. 21281-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

CRYGN, crystallin, gamma N, Gamma crystallin N, Gamma N crystallin

---

Tested Applications

• Positive WB detected in: mouse eye tissue

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21281-1-AP targets CRYGN in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15795

  Product name: Recombinant human CRYGN protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-182 aa of BC100880

  Sequence: MAQRSGKITLYEGKHFTGQKLEVFGDCDNFQDRGFMNRVNSIHVESGAWVCFNHPDFRGQQFILEHGDYPDFFRWNSHSDHMGSCRPVGMHGEHFRLEIFEGCNFTGQCLEFLEDSPFLQSRGWVKNCVNTIKVYGDGAAWSPRSFGAEDFQLSSSLQSDQGPEEATTKPATTQPPFLTANL

• Full Name: crystallin, gamma N
• Calculated Molecular Weight: 182 aa, 21 kDa
• Observed Molecular Weight: 17 kDa, 25 kDa
• GenBank Accession Number: BC100880
• Gene Symbol: CRYGN
• Gene ID (NCBI): 155051
• RRID: AB_2878833
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8WXF5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.