• Featured Product
  • KD/KO Validated

Citrate synthase Recombinant monoclonal antibody, PBS Only (Detector)

Citrate synthase Uni-rAb® Recombinant Antibody for WB, IF/ICC, Cytometric bead array, Indirect ELISA
Cat No. 86549-1-PBS
Clone No.251433D2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Cytometric bead array, Indirect ELISA

CS, CISY, Citrate, Citrate synthase, mitochondrial, EC:2.3.3.1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

86549-1-PBS targets Citrate synthase as part of a matched antibody pair:

MP02513-1: 86549-2-PBS capture and 86549-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag9117

Product name: Recombinant human CS protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 132-466 aa of BC010106

Sequence: EQVSWLSKEWAKRAALPSHVVTMLDNFPTNLHPMSQLSAAVTALNSESNFARAYAQGISRTKYWELIYEDSMDLIAKLPCVAAKIYRNLYREGSGIGAIDSNLDWSHNFTNMLGYTDHQFTELTRLYLTIHSDHEGGNVSAHTSHLVGSALSDPYLSFAAAMNGLAGPLHGLANQEVLVWLTQLQKEVGKDVSDEKLRDYIWNTLNSGRVVPGYGHAVLRKTDPRYTCQREFALKHLPNDPMFKLVAQLYKIVPNVLLEQGKAKNPWPNVDAHSGVLLQYYGMTEMNYYTVLFGVSRALGVLAQLIWSRALGFPLERPKSMSTEGLMKFVDSKSG

Predict reactive species
Full Name citrate synthase
Calculated Molecular Weight 466 aa, 52 kDa
Observed Molecular Weight 45-50 kDa
GenBank Accession NumberBC010106
Gene Symbol Citrate Synthase
Gene ID (NCBI) 1431
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO75390
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Citrate synthase (CS), the first and rate-limiting enzyme of the tricarboxylic acid cycle, plays a key role in regulating energy generation of mitochondrial respiration(PMID:19479947).It belongs to the citrate synthase family. The deduced 466-amino acid protein contains an N-terminal mitochondrial targeting sequence and a motif highly conserved in citrate synthases(PMID:12549038). It can exsit as a dimer(PMID:8749851). Northern blot analysis detected no CS expression in thymus and small intestine(PMID:12549038).

Loading...
||
New chat Able
正在加载,请稍候...