Citrate synthase Recombinant monoclonal antibody, PBS Only (Detector)

• 

  WB analysis using 86549-1-RR (same clone as 86549-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86549-1-RR (CS antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86549-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse heart using 86549-1-RR (same clone as 86549-1-PBS)

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 86549-1-RR (CS antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86549-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 86549-1-RR (same clone as 86549-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using CS antibody (86549-1-RR, Clone: 251433D2 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 86549-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U2OS using 86549-1-RR (same clone as 86549-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using CS antibody (86549-1-RR, Clone: 251433D2 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 86549-1-PBS in a different storage buffer formulation.

• 

  Cytometric bead array sample test of MP02513-1

  The mean Citrate synthase concentration was determined to be 135.1 ng/mL in HepG2 cell extract based on a 1.3 mg/mL extract load.

• 

  Cytometric bead array standard curve of MP02513-1

  Cytometric bead array standard curve of MP02513-1, Citrate synthase Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 86549-2-PBS. Detection antibody: 86549-1-PBS. Standard: Ag9117. Range: 6.25-200 ng/mL.

• 

  Affinity and Kinetic Characterization of 86549-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86549-1-RR against Human Citrate synthase were performed. The affinity constant is 0.995 nM.

Citrate synthase Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Cytometric bead array, Indirect ELISA

Cat No. 86549-1-PBS

Clone No.251433D2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Cytometric bead array, Indirect ELISA

Synonyms

CS, CISY, Citrate, Citrate synthase, mitochondrial, EC:2.3.3.1

---

Product Information

86549-1-PBS targets Citrate synthase as part of a matched antibody pair:

MP02513-1: 86549-2-PBS capture and 86549-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag9117

  Product name: Recombinant human CS protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 132-466 aa of BC010106

  Sequence: EQVSWLSKEWAKRAALPSHVVTMLDNFPTNLHPMSQLSAAVTALNSESNFARAYAQGISRTKYWELIYEDSMDLIAKLPCVAAKIYRNLYREGSGIGAIDSNLDWSHNFTNMLGYTDHQFTELTRLYLTIHSDHEGGNVSAHTSHLVGSALSDPYLSFAAAMNGLAGPLHGLANQEVLVWLTQLQKEVGKDVSDEKLRDYIWNTLNSGRVVPGYGHAVLRKTDPRYTCQREFALKHLPNDPMFKLVAQLYKIVPNVLLEQGKAKNPWPNVDAHSGVLLQYYGMTEMNYYTVLFGVSRALGVLAQLIWSRALGFPLERPKSMSTEGLMKFVDSKSG

• Full Name: citrate synthase
• Calculated Molecular Weight: 466 aa, 52 kDa
• Observed Molecular Weight: 45-50 kDa
• GenBank Accession Number: BC010106
• Gene Symbol: Citrate Synthase
• Gene ID (NCBI): 1431
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O75390
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Citrate synthase (CS), the first and rate-limiting enzyme of the tricarboxylic acid cycle, plays a key role in regulating energy generation of mitochondrial respiration(PMID:19479947).It belongs to the citrate synthase family. The deduced 466-amino acid protein contains an N-terminal mitochondrial targeting sequence and a motif highly conserved in citrate synthases(PMID:12549038). It can exsit as a dimer(PMID:8749851). Northern blot analysis detected no CS expression in thymus and small intestine(PMID:12549038).