CSAD Polyclonal antibody

• 

  IHC staining of human liver using 22870-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 22870-1-AP (CSAD antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver using 22870-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 22870-1-AP (CSAD antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver using 22870-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver using 22870-1-AP (CSAD antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human liver using 22870-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver using 22870-1-AP (CSAD antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human pancreas using 22870-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas using 22870-1-AP (CSAD antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human pancreas using 22870-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas using 22870-1-AP (CSAD antibody) at dilution of 1:50 (under 40x lens).

• 

  IF Staining of MCF-7 using 22870-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed MCF-7 cells using CSAD antibody (22870-1-AP) at dilution of 1:200 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4).

CSAD Polyclonal Antibody for IHC, IF/ICC, ELISA

Cat No. 22870-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, IF/ICC, ELISA

Synonyms

PCAP, EC:4.1.1.29, EC:4.1.1.11, Cysteine-sulfinate decarboxylase, CSD

---

Tested Applications

• Positive IHC detected in: human liver tissue, human pancreas tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: MCF-7 cells

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

22870-1-AP targets CSAD in IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15828

  Product name: Recombinant human CSAD protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 344-493 aa of BC098278

  Sequence: DVALDTGDKVVQCGRRVDCLKLWLMWKAQGDQGLERRIDQAFVLARYLVEEMKKREGFELVMEPEFVNVCFWFVPPSLRGKQESPDYHERLSKVAPVLKERMVKEGSMMIGYQPHGTRGNFFRVVVANSALTCADMDFLLNELERLGQDL

• Full Name: cysteine sulfinic acid decarboxylase
• Calculated Molecular Weight: 493 aa, 55 kDa
• GenBank Accession Number: BC098278
• Gene Symbol: CSAD
• Gene ID (NCBI): 51380
• RRID: AB_11183049
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y600
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.