• Featured Product
  • KD/KO Validated

CSDA Polyclonal antibody

CSDA Polyclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 27785-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

cold shock domain protein A, Cold shock domain-containing protein A, DBPA, DNA-binding protein A, Single-strand DNA-binding protein NF-GMB

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inY79 cells, KYSE-30 cells, mouse liver tissue, rat liver tissue
Positive IHC detected inmouse heart tissue, mouse skeletal muscle tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inA431 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 1 publications below

Product Information

27785-1-AP targets CSDA in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivitymouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag26839

Product name: Recombinant human CSDA protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-300 aa of BC008801

Sequence: MSEAGEATTTTTTTLPQAPTEAAAAAPQDPAPKSPVGSGAPQAAAPAPAAHVAGNPGGDAAPAATGTAAAASLAAAAGSEDAEKKVLATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPDGVPVEGSRYAADRRRYRRGYYGRRRGPPRNYAGEEEEEGSGSSEGFDPPATDRQFSGARNQLRRPQYRPQYRQRRFPPYHVGQTFDRRSRVLPHPNRIQAGEIGEMKDGVPEGAQLQGPVHRNPTYRPRYRSRGPPRPR

Predict reactive species
Full Name cold shock domain protein A
Calculated Molecular Weight 40 kDa
Observed Molecular Weight60-68 kDa
GenBank Accession NumberBC008801
Gene Symbol CSDA
Gene ID (NCBI) 8531
RRIDAB_3085996
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP16989
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CSDA (Cold shock domain protein A), also known as DBPA (DNA-binding protein A), YBX3 (Y-box protein 3), is a DNA-binding protein that represses angiogenesis and lymphangiogenesis by directly binding to hypoxia response element (HRE) and serum response element (SRE). CSDA is ubiquitous expressed in human skeletal muscle, heart, and decidual cells, which is thought to a multifunctional epithelial-specific protein involved in gene transcription, DNA repair, and interaction with other proteins (PMID: 33816248). CSDA is a nucleic-acid-binding protein that directly regulates gene expression by using different mechanisms, and acts as a translational repressor (e.g., MYH9 and SPTBN1) and positive regulator of mRNA stability (PMID: 31189097). Western blot analysis detected CDSA at a range of 50~70 kDa due to the anomalous mobility of Y-box proteins (PMID: 38255791).

Protocols

Product Specific Protocols
IF protocol for CSDA antibody 27785-1-APDownload protocol
IHC protocol for CSDA antibody 27785-1-APDownload protocol
WB protocol for CSDA antibody 27785-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Mol Metab

RNA-binding protein YBX3 promotes PPARγ-SLC3A2 mediated BCAA metabolism fueling brown adipogenesis and thermogenesis

Authors - Lin-Yun Chen
Loading...
||
New chat Able
正在加载,请稍候...