Mouse CSF1R/CD115 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of RAW 264.7 using 84919-4-RR (same clone as 84919-4-PBS)

  RAW 264.7 cells were subjected to SDS PAGE followed by western blot with 84919-4-RR (CSF1R/CD115 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84919-4-PBS in a different storage buffer formulation.

• 

  IF Staining of RAW 264.7 using 84919-4-RR (same clone as 84919-4-PBS)

  Immunofluorescent analysis of (4% PFA) fixed RAW 264.7 cells using CSF1R/CD115 antibody (84919-4-RR, Clone: 242213E1 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 84919-4-PBS in a different storage buffer formulation.

CSF1R/CD115 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 84919-4-PBS

Clone No.242213E1

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

Csf1r, 242213E1, CD115, CSF 1R, CSF-1 receptor

---

Product Information

84919-4-PBS targets CSF1R/CD115 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1816

  Product name: Recombinant Mouse CSF1R protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 20-511 aa of NM_001037859.2

  Sequence: APVIEPSGPELVVEPGETVTLRCVSNGSVEWDGPISPYWTLDPESPGSTLTTRNATFKNTGTYRCTELEDPMAGSTTIHLYVKDPAHSWNLLAQEVTVVEGQEAVLPCLITDPALKDSVSLMREGGRQVLRKTVYFFSPWRGFIIRKAKVLDSNTYVCKTMVNGRESTSTGIWLKVNRVHPEPPQIKLEPSKLVRIRGEAAQIVCSATNAEVGFNVILKRGDTKLEIPLNSDFQDNYYKKVRALSLNAVDFQDAGIYSCVASNDVGTRTATMNFQVVESAYLNLTSEQSLLQEVSVGDSLILTVHADAYPSIQHYNWTYLGPFFEDQRKLEFITQRAIYRYTFKLFLNRVKASEAGQYFLMAQNKAGWNNLTFELTLRYPPEVSVTWMPVNGSDVLFCDVSGYPQPSVTWMECRGHTDRCDEAQALQVWNDTHPEVLSQKPFDKVIIQSQLPIGTLKHNMTYFCKTHNSVGNSSQYFRAVSLGQSKQLPDES

• Full Name: colony stimulating factor 1 receptor
• Calculated Molecular Weight: 109 kDa
• Observed Molecular Weight: 165 kDa
• GenBank Accession Number: NM_001037859.2
• Gene Symbol: CSF1R/CD115
• Gene ID (NCBI): 12978
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P09581
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CSF1R (colony-stimulating factor 1 receptor) belongs to the type III protein tyrosine kinase receptor family. CSF1R-mediated signaling is crucial for the differentiation and survival of the mononuclear phagocyte system and macrophages in particular (PMID: 28716061).