CSF1R/CD115 Recombinant monoclonal antibody

• 

  WB analysis using 84919-6-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 84919-6-RR (CSF1R/CD115 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse spleen using 84919-6-RR

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 84919-6-RR (M-CSF R/CD115 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse spleen using 84919-6-RR

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 84919-6-RR (M-CSF R/CD115 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  Affinity and Kinetic Characterization of 84919-6-RR

  Biolayer interferometry (BLl) kinetic assays of 84919-6-RR against Mouse CSF1R/CD115 were performed. The affinity constant is below 1 pM.

CSF1R/CD115 Uni-rAb^® Recombinant Antibody for WB, IHC, ELISA

Cat No. 84919-6-RR

Clone No.242213G11

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, IHC, ELISA

Synonyms

Csf1r, CD115, CSF 1R, CSF-1 receptor, Csfmr

---

Tested Applications

• Positive WB detected in: J774A.1 cells, RAW 264.7 cells, mouse spleen tissue
• Positive IHC detected in: mouse spleen tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

84919-6-RR targets CSF1R/CD115 in WB, IHC, ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1816

  Product name: Recombinant Mouse CSF1R protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 20-511 aa of NM_001037859.2

  Sequence: APVIEPSGPELVVEPGETVTLRCVSNGSVEWDGPISPYWTLDPESPGSTLTTRNATFKNTGTYRCTELEDPMAGSTTIHLYVKDPAHSWNLLAQEVTVVEGQEAVLPCLITDPALKDSVSLMREGGRQVLRKTVYFFSPWRGFIIRKAKVLDSNTYVCKTMVNGRESTSTGIWLKVNRVHPEPPQIKLEPSKLVRIRGEAAQIVCSATNAEVGFNVILKRGDTKLEIPLNSDFQDNYYKKVRALSLNAVDFQDAGIYSCVASNDVGTRTATMNFQVVESAYLNLTSEQSLLQEVSVGDSLILTVHADAYPSIQHYNWTYLGPFFEDQRKLEFITQRAIYRYTFKLFLNRVKASEAGQYFLMAQNKAGWNNLTFELTLRYPPEVSVTWMPVNGSDVLFCDVSGYPQPSVTWMECRGHTDRCDEAQALQVWNDTHPEVLSQKPFDKVIIQSQLPIGTLKHNMTYFCKTHNSVGNSSQYFRAVSLGQSKQLPDES

• Full Name: colony stimulating factor 1 receptor
• Calculated Molecular Weight: 109 kDa
• Observed Molecular Weight: 110-170 kDa
• GenBank Accession Number: NM_001037859.2
• Gene Symbol: CSF1R/CD115
• Gene ID (NCBI): 12978
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P09581
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CSF1R (colony-stimulating factor 1 receptor) belongs to the type III protein tyrosine kinase receptor family. CSF1R-mediated signaling is crucial for the differentiation and survival of the mononuclear phagocyte system and macrophages in particular (PMID: 28716061).