CSHL1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CSHL1 Polyclonal antibody, PBS Only (11883-1-PBS)

• 

  WB analysis of human placenta using 11883-1-AP (same clone as 11883-1-PBS)

  human placenta tissue were subjected to SDS PAGE followed by western blot with 11883-1-AP (CSHL1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11883-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human placenta using 11883-1-AP (same clone as 11883-1-PBS)

  human placenta tissue were subjected to SDS PAGE followed by western blot with 11883-1-AP (CSHL1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11883-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 11883-1-AP (same clone as 11883-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta using 11883-1-AP (CSHL1 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 11883-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 11883-1-AP (same clone as 11883-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta using 11883-1-AP (CSHL1 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 11883-1-PBS in a different storage buffer formulation.

CSHL1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 11883-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

11883-1-PBS targets CSHL1 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2487

  Product name: Recombinant human CSHL1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-136 aa of BC029365

  Sequence: DSIPTSSNMEETQQKSNLELLHISLLLIESRLEPVRFLRSTFTNNLVYDTSDSDDYHLLKDLEEGIQMLMGRLEDGSHLTGQTLKQTYSKFDTNSHNHDALLKNYGLLHCFRKDMDKVETFLRMVQCRSVEGSCGF

• Full Name: chorionic somatomammotropin hormone-like 1
• Calculated Molecular Weight: 199 aa, 23 kDa
• Observed Molecular Weight: 23 kDa
• GenBank Accession Number: BC029365
• Gene Symbol: CSHL1
• Gene ID (NCBI): 1444
• RRID: AB_2084008
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q14406
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.