CSN2 Monoclonal antibody, PBS Only

CSN2 Monoclonal Antibody for WB, IHC, IF-P, Indirect ELISA
Cat No. 66435-1-PBS
Clone No.2H10E6

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, Indirect ELISA

ALIEN, Alien homolog, COPS2, CSN2, SGN2, Signalosome subunit 2, TR interacting protein 15, TRIP 15, TRIP15

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66435-1-PBS targets CSN2 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag1415

Product name: Recombinant human COPS2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-443 aa of BC012629

Sequence: MSDMEDDFMCDDEEDYDLEYSEDSNSEPNVDLENQYYNSKALKEDDPKAALSSFQKVLELEGEKGEWGFKALKQMIKINFKLTNFPEMMNRYKQLLTYIRSAVTRNYSEKSINSILDYISTSKQMDLLQEFYETTLEALKDAKNDRLWFKTNTKLGKLYLEREEYGKLQKILRQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKALYEQSLHIKSAIPHPLIMGVIRECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSGINPFDSQEAKPYKNDPEILAMTNLVSAYQNNDITEFEKILKTNHSNIMDDPFIREHIEELLRNIRTQVLIKLIKPYTRIHIPFISKELNIDVADVESLLVQCILDNTIHGRIDQVNQLLELDHQKRGGARYTALDKWTNQLNSLNQAVVSKLA

Predict reactive species
Full Name COP9 constitutive photomorphogenic homolog subunit 2 (Arabidopsis)
Calculated Molecular Weight 52 kDa
Observed Molecular Weight 52 kDa
GenBank Accession NumberBC012629
Gene Symbol COPS2
Gene ID (NCBI) 9318
RRIDAB_2881805
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP61201
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

COPS2 is an essential component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF-type complexes such as SCF, CSA or DDB2. The complex is also involved in phosphorylation of p53/TP53, c-jun/JUN, IkappaBalpha/NFKBIA, ITPK1 and IRF8/ICSBP, possibly via its association with CK2 and PKD kinases. CSN-dependent phosphorylation of TP53 and JUN promotes and protects degradation by the Ubl system, respectively.

Loading...
||
New chat Able
正在加载,请稍候...