CSNK1A1L Polyclonal antibody

• 

  WB analysis of HeLa using 17125-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 17125-1-AP (CSNK1A1L antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 17125-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 17125-1-AP (CSNK1A1L antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Transfected HEK-293 using 17125-1-AP

  Transfected HEK-293 cells were subjected to SDS PAGE followed by western blot with 17125-1-AP (CSNK1A1L Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 17125-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 17125-1-AP (CSNK1A1L antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human testis using 17125-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis using 17125-1-AP (CSNK1A1L antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human testis using 17125-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis using 17125-1-AP (CSNK1A1L antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of human skin using 17125-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin using 17125-1-AP (CSNK1A1L antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human skin using 17125-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin using 17125-1-AP (CSNK1A1L antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of human brain using 17125-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain using 17125-1-AP (CSNK1A1L antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human brain using 17125-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain using 17125-1-AP (CSNK1A1L antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of human lung using 17125-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung using 17125-1-AP (CSNK1A1L antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human lung using 17125-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung using 17125-1-AP (CSNK1A1L antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of human ovary using 17125-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary using 17125-1-AP (CSNK1A1L antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human ovary using 17125-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary using 17125-1-AP (CSNK1A1L antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of human lung using 17125-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung using 17125-1-AP (CSNK1A1L antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human lung using 17125-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung using 17125-1-AP (CSNK1A1L antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of human ovary using 17125-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary using 17125-1-AP (CSNK1A1L antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human ovary using 17125-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary using 17125-1-AP (CSNK1A1L antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of human kidney using 17125-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 17125-1-AP (CSNK1A1L antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human kidney using 17125-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 17125-1-AP (CSNK1A1L antibody) at dilution of 1:100 (under 40x lens).

CSNK1A1L Polyclonal Antibody for WB, IHC, ELISA

Cat No. 17125-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

casein kinase 1, alpha 1 like, CK1, CKI alpha like, CSNK1A1L, RP11 532O21.2

---

Tested Applications

• Positive WB detected in: HeLa cells, Transfected HEK-293 cells
• Positive IHC detected in: human testis tissue, human brain tissue, human kidney tissue, human lung tissue, human ovary tissue, human skin tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

17125-1-AP targets CSNK1A1L in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10814

  Product name: Recombinant human CSNK1A1L protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-337 aa of BC028723

  Sequence: MTNNSGSKAELVVGGKYKLVRKIGSGSFGDVYLGITTTNGEEVAVKLESQKVKHPQLLYESKLYTILQGGVGIPHMHWYGQEKDNNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFLHRDIKPDNFLMGTGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKHLIGTVRYASINAHLGIEQSRRDDMESLGYVFMYFNRTSLPWQGLKAMTKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEVPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAAQQAASSSGQGQQAQTQTGKQTEKNKNNVKDN

• Full Name: casein kinase 1, alpha 1-like
• Calculated Molecular Weight: 337 aa, 39 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC028723
• Gene Symbol: CSNK1A1L
• Gene ID (NCBI): 122011
• RRID: AB_2084665
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N752
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.