CSRP1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86265-3-RR (same clone as 86265-3-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86265-3-RR (CSRP1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86265-3-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 86265-3-RR

  Biolayer interferometry (BLl) kinetic assays of 86265-3-RR against Human CSRP1 were performed. The affinity constant is below 1 pM.

CSRP1 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 86265-3-PBS

Clone No.250876D8

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

CRP, CRP1, CSRP, CYRP, Cysteine and glycine-rich protein 1

---

Product Information

86265-3-PBS targets CSRP1 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag4236

  Product name: Recombinant human CSRP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-193 aa of BC032493

  Sequence: MPNWGGGKKCGVCQKTVYFAEEVQCEGNSFHKSCFLCMVCKKNLDSTTVAVHGEEIYCKSCYGKKYGPKGYGYGQGAGTLSTDKGESLGIKHEEAPGHRPTTNPNASKFAQKIGGSERCPRCSQAVYAAEKVIGAGKSWHKACFRCAKCGKGLESTTLADKDGEIYCKGCYAKNFGPKGFGFGQGAGALVHSE

• Full Name: cysteine and glycine-rich protein 1
• Calculated Molecular Weight: 193 aa, 21 kDa
• Observed Molecular Weight: 21 kDa
• GenBank Accession Number: BC032493
• Gene Symbol: CSRP1
• Gene ID (NCBI): 1465
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P21291
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CSRP1 (Cysteine and glycine-rich protein 1), designated initially as CRP1, constitutes a cysteine-rich protein derived from placental sources and exhibits a response profile analogous to c-myc. CSRP1 has been recognized as a tumor suppressor in several types of cancers including colorectal cancer, and cholangiocarcinoma (PMID: 37113556). Abnormal expression of CSRP1 was reported within several malignancies such as prostate cancer and acute myeloid leukemia (PMID: 38813484, 40198006).