CST1 Recombinant monoclonal antibody, PBS Only (Capture)

• 

  Sandwich ELISA standard curve of MP01926-3

  Sandwich ELISA standard curve of MP01926-3, Human Cystatin SN/CST1 Recombinant Matched Antibody Pair - PBS only. 85403-4-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag8862. 85403-1-PBS was HRP conjugated as the detection antibody. Range: 1.56-10 ng/mL

• 

  Sample test of MP01926-3

  Urine of seven individual healthy human donors was measured. The human Cystatin SN/CST1 concentration of detected samples was determined to be 0.70 ng/mL with a range of 0.16 - 2.31 ng/mL.

• 

  Sample test of MP01926-3

  Serum of eight individual healthy human donors was measured. The human Cystatin SN/CST1 concentration of detected samples was determined to be 5.27 ng/mL with a range of 2.95 - 7.40 ng/mL.

CST1 Uni-rAb^® Recombinant Antibody for Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 85403-4-PBS

Clone No.242888G4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

Cystain SA I, Cystain-SA-I, Cystatin 1, cystatin SN, Cystatin SN/CST1

---

Product Information

85403-4-PBS targets CST1 as part of a matched antibody pair:

MP01926-3: 85403-4-PBS capture and 85403-1-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag8862

  Product name: Recombinant human CST1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 24-141 aa of BC021225

  Sequence: KEEDRIIPGGIYNADLNDEWVQRALHFAISEYNKATKDDYYRRPLRVLRARQQTVGGVNYFFDVEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSFEIYEVPWENRRSLVKSRCQES

• Full Name: cystatin SN
• Calculated Molecular Weight: 141 aa, 16 kDa
• GenBank Accession Number: BC021225
• Gene Symbol: CST1
• Gene ID (NCBI): 1469
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P01037
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.