Cystatin F Polyclonal antibody

• 

  WB analysis of mouse uterus using 12073-1-AP

  mouse uterus tissue were subjected to SDS PAGE followed by western blot with 12073-1-AP (Cystatin F antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 12073-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 12073-1-AP (Cystatin F antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

Cystatin F Polyclonal Antibody for ELISA

Cat No. 12073-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

ELISA

Synonyms

CMAP, CST7, Cystatin 7, Cystatin F, cystatin F (leukocystatin), Leukocystatin

---

Product Information

12073-1-AP targets Cystatin F in ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2697

  Product name: Recombinant human CST7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-167 aa of BC015507

  Sequence: MLPEKALHGHPQLPRTVPTRAAMRAAGTLLAFCCLVLSTTGGPSPDTCSQDLNSRVKPGFPKTIKTNDPGVLQAARYSVEKFNNCTNDMFLFKESRITRALVQIVKGLKYMLEVEIGRTTCKKNQHLRLDDCDFQTNHTLKQTLSCYSEVWVVPWLQHFEVPVLRCH

• Full Name: cystatin F (leukocystatin)
• Calculated Molecular Weight: 167 aa, 19 kDa
• GenBank Accession Number: BC015507
• Gene Symbol: Cystatin F
• Gene ID (NCBI): 8530
• RRID: AB_2086210
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O76096
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.