CSTF1 Polyclonal antibody

• 

  WB analysis using 15537-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15537-1-AP (CSTF1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 15537-1-AP

  IP result of anti-CSTF1 (IP:15537-1-AP, 4ug; Detection:15537-1-AP 1:500) with HeLa cells lysate 680 ug.

• 

  IF Staining of HeLa using 15537-1-AP

  Immunofluorescent analysis of (10% Formaldehyde) fixed HeLa cells using 15537-1-AP (CSTF1 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

CSTF1 Polyclonal Antibody for WB, IF/ICC, IP, ELISA

Cat No. 15537-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, IP, ELISA

Synonyms

CstF-50, CstF50, CF-1 50 kDa subunit

---

Tested Applications

• Positive WB detected in: HeLa cells, HEK-293T cells, A549 cells
• Positive IP detected in: HeLa cells
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15537-1-AP targets CSTF1 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7874

  Product name: Recombinant human CSTF1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-177 aa of BC007425

  Sequence: MYRTKVGLKDRQQLYKLIISQLLYDGYISIANGLINEIKPQSVCAPSEQLLHLIKLGMENDDTAVQYAIGRSDTVAPGTGIDLEFDADVQTMSPEASEYETCYVTSHKGPCRVATYSRDGQLIATGSADASIKILDTERMLAKSAMPIEVMMNETAQQNMENHPVIRTLYDHVDEVT

• Full Name: cleavage stimulation factor, 3' pre-RNA, subunit 1, 50kDa
• Calculated Molecular Weight: 48 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC007425
• Gene Symbol: CSTF1
• Gene ID (NCBI): 1477
• RRID: AB_2261143
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q05048
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cleavage stimulation factor (CstF) , a heterotrimeric protein with subunits of 77, 64, and 50 kD (CstF-77, -64, and -50), is a polyadenylation factor that helps to specify the site of processing. CstF recognizes the G+U-rich element, a sequence located downstream of the cleavage site. CstF-50 unit interacts with the COOH-terminal domain of the RNAP II largest subunit (CTD).