CT55 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CT55 Polyclonal antibody (32040-1-AP)

• 

  WB analysis using 32040-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32040-1-AP (CXorf48 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

CT55 Polyclonal Antibody for WB, ELISA

Cat No. 32040-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

Cancer/testis antigen 55, CXorf48, Tumor antigen BJ-HCC-20

---

Tested Applications

• Positive WB detected in: human testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32040-1-AP targets CT55 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36155

  Product name: Recombinant human CXorf48 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-168 aa of BC020662

  Sequence: MLRLLRLALAFYGRTADPAERQGPQQQGLPQGDTQLTTVQGVVTSFCGDYGMIDESIYFSSDVVTGNVPLKVGQKVNVVVEEDKPHYGLRAIKVDVVPRHLYGAGPSDSGTRVLIGCVTSINEDNIYISNSIYFSIAIVSEDFVPYKGDLLEVEYSTEPGISNIKATS

• Full Name: chromosome X open reading frame 48
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC020662
• Gene Symbol: CXorf48
• Gene ID (NCBI): 54967
• RRID: AB_3742514
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q8WUE5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The Cancer/Testis Antigen (CTA) genes comprise a group of genes whose expression under physiological conditions is restricted to the testis but is activated in many human cancers. CT55 is a new autophagic manipulator to regulate spermatogenesis via selectively interacting with LAMP2 and GABARAP (which are key regulators in the autophagy process) and further fine-tuning their expression. Cancer-testis antigen 55 (CT55) mutation induced male infertility with extreme disruption in sperm production, morphology, and locomotion (PubMed:36481789).