CTAGE1 Monoclonal antibody, PBS Only

• 

  WB analysis of HeLa using 60087-1-Ig (same clone as 60087-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 60087-1-Ig (CTAGE1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60087-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 60087-1-Ig (same clone as 60087-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 60087-1-Ig (CTAGE1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60087-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 60087-1-Ig (same clone as 60087-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 60087-1-Ig (CTAGE1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60087-1-PBS in a different storage buffer formulation.

• 

  IF Staining of Jurkat using 60087-1-Ig (same clone as 60087-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed Jurkat cells using CTAGE1 antibody (60087-1-Ig, Clone: 3B4C2 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). This data was developed using the same antibody clone with 60087-1-PBS in a different storage buffer formulation.

CTAGE1 Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 60087-1-PBS

Clone No.3B4C2

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

3B4C2, Cancer/testis antigen 21.2, CT21.1, CT21.2, CT21.2,CTAGE2

---

Product Information

60087-1-PBS targets CTAGE1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3948

  Product name: Recombinant human CTAGE1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 466-780 aa of BC031065

  Sequence: DNWSAAWTAERNLNDLRKENAHNRQKLTEIEFKIKLLEKDPYGLDVPNTAFGRQHSPYGPSPLGWPSSETRASLYPPTLLEGPLRLSPLLPRGGGRGSRGPGNPPDHQITKERGESSCDRLTDPHRAPSDAGPLAPPWEQDYRMMFPPPGQSYPDSALPPQRQDRFYSNCARLSGPAELRSFNMPSLDKMDGSMPSEMESSRNDTKDNLGNLKVPDSSLPAENEATGPGFVPPPLAPIRGLLFPVDTRGPFIRRGPPFPPPPPGTVFGASPDYFSPRDVPGPPRAPFAMRNVYLPRGFLPYRPPRPAFFPPAPTF

• Full Name: cutaneous T-cell lymphoma-associated antigen 1
• Calculated Molecular Weight: 754 aa, 89 kDa
• Observed Molecular Weight: 120 kDa
• GenBank Accession Number: BC031065
• Gene Symbol: CTAGE1
• Gene ID (NCBI): 64693
• RRID: AB_2086620
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q96RT6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.