MARK3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• MARK3 Polyclonal antibody (12932-1-AP)

MARK3 Polyclonal Antibody for WB, IP, ELISA

Cat No. 12932-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, ELISA

Synonyms

C TAK1, CTAK1, ELKL motif kinase 2, EMK 2, EMK2, KP78, MARK3, PAR1A, Protein kinase STK10, Ser/Thr protein kinase PAR 1

• 

  WB analysis of human brain using 12932-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 12932-1-AP (MARK3 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of PC-3 using 12932-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 12932-1-AP (MARK3 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human brain using 12932-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 12932-1-AP (MARK3 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse brain using 12932-1-AP

  IP result of anti-MARK3 (IP:12932-1-AP, 3ug; Detection:12932-1-AP 1:500) with mouse brain tissue lysate 4000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for MARK3 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: human brain tissue, PC-3 cells
• Positive IP detected in: mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12932-1-AP targets MARK3 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3805

  Product name: Recombinant human CTAK1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-330 aa of BC024773

  Sequence: MSTRTPLPTVNERDTENHTSHGDGRQEVTSRTSRSGARCRNSIASCADEQPHIGNYRLLKTIGKGNFAKVKLARHILTGREVAIKIIDKTQLNPTSLQKLFREVRIMKILNHPNIVKLFEVIETEKTLYLIMEYASGGEVFDYLVAHGRMKEKEARSKFRQIVSAVQYCHQKRIVHRDLKAENLLLDADMNIKIADFGFSNEFTVGGKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKRFLVLNPIKRGTLEQIMKDRWINAGHEEDELKPFVEPELDISDQK

• Full Name: MAP/microtubule affinity-regulating kinase 3
• Calculated Molecular Weight: 78 kDa, 80 kDa
• Observed Molecular Weight: 80-90 kDa
• GenBank Accession Number: BC024773
• Gene Symbol: MARK3
• Gene ID (NCBI): 4140
• RRID: AB_10638613
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P27448
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The MARK3 polyclonal antibody (Cat# 12932-1-AP) has 1 citation. It appears in Free Radical Biology and Medicine (IF: 8), in a study investigating how sophoridine alleviates sepsis-associated encephalopathy by inhibiting MARK4 and NLRP3 signaling. The research field encompasses sepsis, neuroinflammation, and innate immune signaling pathways. The antibody was applied in Western blot using mouse samples.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Free Radic Biol Med; Sophoridine alleviates sepsis-associated encephalopathy by inhibiting MARK4 and NLRP3 signaling.; Authors - Kunmei Xie