Tested Applications
| Positive WB detected in | mouse brain tissue, mouse heart tissue, rat brain tissue |
| Positive IP detected in | mouse heart tissue |
| Positive IHC detected in | human pancreas cancer tissue, human stomach tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:1000-1:4000 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10346-1-AP targets CTBP2 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, zebrafish, gerbil |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0352 Product name: Recombinant human CTBP2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 24-201 aa of BC002486 Sequence: QIMNGPLHPRPLVALLDGRDCTVEMPILKDLATVAFCDAQSTQEIHEKVLNEAVGAMMYHTITLTREDLEKFKALRVIVRIGSGYDNVDIKAAGELGIAVCNIPSAAVEETADSTICHILNLYRRNTWLYQALREGTRVQSVEQIREVASGAARIRGETLGLIGFGRTGQAVAVRAKA Predict reactive species |
| Full Name | C-terminal binding protein 2 |
| Calculated Molecular Weight | 49 kDa |
| Observed Molecular Weight | 49 kDa |
| GenBank Accession Number | BC002486 |
| Gene Symbol | CTBP2 |
| Gene ID (NCBI) | 1488 |
| RRID | AB_2261202 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P56545 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
C-Terminal binding protein 2 (CTBP2) is a transcriptional repressor. It contains a NAD+ binding domain similar to NAD+-dependent 2-hydroxyacid dehydrogenases. This protein is thought to bind to the C-terminus of the adenovirus E1A proteins. Studies in mice suggested that this protein is involved in transcriptional repression. CTBP2 is expressed in all tissues tested, with a higher level of expression in the heart, skeletal muscle, and pancreas. The gene of CTBP2 is mapped to human chromosome 21q21.3.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for CTBP2 antibody 10346-1-AP | Download protocol |
| IF protocol for CTBP2 antibody 10346-1-AP | Download protocol |
| IHC protocol for CTBP2 antibody 10346-1-AP | Download protocol |
| IP protocol for CTBP2 antibody 10346-1-AP | Download protocol |
| WB protocol for CTBP2 antibody 10346-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The CTBP2 Polyclonal antibody (catalog no. 10346-1-AP) has 15 citations. These appear in journals including Nature Immunology, Nature Ecology & Evolution, Journal of Clinical Investigation, PLoS Biology, Investigative Ophthalmology & Visual Science, Frontiers in Pharmacology, Frontiers in Physiology, Journal of Neuroscience, Molecular Carcinogenesis, Neural Plasticity, Gene, Clinical and Experimental Pharmacology and Physiology, Proteome Science, and Genomics. Research fields span immunology, cancer, neurobiology, auditory/retinal development, and metabolism.
| Species | Application | Title |
|---|---|---|
Nat Immunol The epitranscriptional factor PCIF1 orchestrates CD8+ T cell ferroptosis and activation to control antitumor immunity
| ||
J Clin Invest The CTBP2-PCIF1 complex regulates m6Am modification of mRNA in head and neck squamous cell carcinoma
| ||
Invest Ophthalmol Vis Sci Novel Grm6 Variant in a no b-wave (nob) Mouse Model: Phenotype Characterization and Gene Therapy | ||
Front Pharmacol Ling-gui-zhu-gan promotes adipocytes browning via targeting the miR-27b/PRDM16 pathway in 3T3-L1 cells |
Reviews
What customers say
The single review for this product is highly positive, giving it a 5-star rating. The reviewer used it for immunohistochemistry and immunofluorescence at a 1:100 dilution on retinal organoids, praising its high specificity and sensitivity. They noted that it delivers reliable and reproducible results, making it a dependable reagent for their applications. Overall, the feedback highlights strong performance and consistency.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Alessandro (Verified Customer) (02-04-2025) | high specificity and sensitivity, providing reliable and reproducible results
|
