CTNNAL1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CTNNAL1 Polyclonal antibody (32926-1-AP)

• 

  WB analysis of HepG2 using 32926-1-AP

  WB result of CTNNAL1 antibody (32926-1-AP; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-CTNNAL1 transfected HepG2 cells.

• 

  WB analysis using 32926-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32926-1-AP (CTNNAL1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• Featured Product
• KD/KO Validated

CTNNAL1 Polyclonal Antibody for WB, ELISA

Cat No. 32926-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

ACRP, Alpha catenin related protein, alpha CATU, Alpha catulin, Alpha-catenin-related protein

---

Tested Applications

• Positive WB detected in: Caco-2 cells, HepG2 cells, HeLa cells, L02 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32926-1-AP targets CTNNAL1 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38629

  Product name: Recombinant human CTNNAL1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 290-535 aa of NM_003798

  Sequence: ISIFTGIKEFKMNIEALRENLYFQSKENLSVTLEVILERMEDFTDSAYTSHEHRERILELSTQARMELQQLISVWIQAQSKKTKSIAEELELSILKISHSLNELKKELHSTATQLAADLLKYHADHVVLKALKLTGVEGNLEALAEYACKLSEQKEQLVETCRLLRHISGTEPLEITCIHAEETFQVTGQQIISAAETLTLHPSSKIAKENLDVFCEAWESQISDMSTLLREINDVFEGRRGEKYG

• Full Name: catenin (cadherin-associated protein), alpha-like 1
• Calculated Molecular Weight: 82 kDa
• Observed Molecular Weight: 82 kDa
• GenBank Accession Number: NM_003798
• Gene Symbol: CTNNAL1
• Gene ID (NCBI): 8727
• RRID: AB_3742792
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9UBT7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Catenin alpha-like protein 1 (CTNNAL1, also known as alpha-catulin) is a cytoplasmic molecule that integrates the crosstalk between nuclear factor-kappa B (NF-κB) and Rho signaling pathways. It plays a crucial role in maintaining epithelial integrity and promoting wound repair in bronchial epithelial cells. CTNNAL1 has been shown to inhibit ozone-induced airway epithelial-mesenchymal transition and regulate mucus hypersecretion induced by house dust mite (HDM) (PMID: 38602002). Additionally, CTNNAL1 promotes the structural integrity of bronchial epithelial cells through the RhoA/ROCK1 pathway (PMID: 36535402). In cancer, CTNNAL1 regulates cancer stem cells (CSCs) in lung cancer and glioblastoma, modulating their migration and invasion abilities (PMID: 37239133).