CTNNBIP1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CTNNBIP1 Polyclonal antibody (18347-1-AP)

CTNNBIP1 Polyclonal Antibody for IHC, ELISA

Cat No. 18347-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

CTNNBIP1, ICAT

• 

  IHC staining of mouse skin using 18347-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skin tissue slide using 18347-1-AP (CTNNBIP1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse skin using 18347-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skin tissue slide using 18347-1-AP (CTNNBIP1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CTNNBIP1 in ?

Chat with Able

---

Tested Applications

• Positive IHC detected in: mouse skin tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

18347-1-AP targets CTNNBIP1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13160

  Product name: Recombinant human CTNNBIP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-81 aa of BC014300

  Sequence: MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPPHSIDQGAEDVVMAFSRSETEDRRQ

• Full Name: catenin, beta interacting protein 1
• Calculated Molecular Weight: 21 kDa
• GenBank Accession Number: BC014300
• Gene Symbol: CTNNBIP1
• Gene ID (NCBI): 56998
• RRID: AB_3085562
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NSA3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The CTNNBIP1 Polyclonal antibody (Cat# 18347-1-AP) has 1 total citation. It appears in J Cancer (IF 3.4), published in 2020. The cited study investigated functional genetic variants of CTNNBIP1 and their predictive value for platinum treatment response in Chinese epithelial ovarian cancer patients, placing it in the research fields of ovarian cancer, pharmacogenomics, and platinum-based chemotherapy response.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	J Cancer; Functional genetic variants of CTNNBIP1 predict platinum treatment response of Chinese epithelial ovarian cancer patients.; Authors - Haoran Li