CTPS2 Monoclonal antibody, PBS Only (Capture)

CTPS2 Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, Sandwich ELISA, Indirect ELISA
Cat No. 67734-1-PBS
Clone No.1A3B8

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IF-P, Sandwich ELISA, Indirect ELISA

1A3B8, CTP synthase 2, CTP synthase II, CTP synthetase 2, EC:6.3.4.2

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67734-1-PBS targets CTPS2 as part of a matched antibody pair:

MP50097-1: 67734-1-PBS capture and 67734-2-PBS detection (validated in Sandwich ELISA)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag30258

Product name: Recombinant human CTPS2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 30-373 aa of BC034986

Sequence: CGLRVTAIKIDPYINIDAGTFSPYEHGEVFVLNDGGEVDLDLGNYERFLDINLYKDNNITTGKIYQHVINKERRGDYLGKTVQVVPHITDAVQEWVMNQAKVPVDGNKEEPQICVIELGGTIGDIEGMPFVEAFRQFQFKAKRENFCNIHVSLVPQLSATGEQKTKPTQNSVRALRGLGLSPDLIVCRSSTPIEMAVKEKISMFCHVNPEQVICIHDVSSTYRVPVLLEEQSIVKYFKERLHLPIGDSASNLLFKWRNMADRYERLQKICSIALVGKYTKLRDCYASVFKALEHSALAINHKLNLMYIDSIDLEKITETEDPVKFHEAWQKLCKADGILVPGGF

Predict reactive species
Full Name CTP synthase II
Calculated Molecular Weight 586 aa, 66 kDa
Observed Molecular Weight66 kDa
GenBank Accession NumberBC034986
Gene Symbol CTPS2
Gene ID (NCBI) 56474
RRIDAB_2882918
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9NRF8
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

CTPS2 (CTP synthase 2) is also named as UTP--ammonia ligase 2 and belongs to the CTP synthase family.It catalyzes the ATP-dependent amination of UTP to CTP with either L-glutamine or ammonia as the source of nitrogen and constitutes the rate-limiting enzyme in the synthesis of cytosine nucleotides. This antibody specifically detects only CTPS2 and not also CTPS1.

Loading...
||
New chat Able
正在加载,请稍候...