CTR9 Recombinant monoclonal antibody, PBS Only (Detector)

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• CTR9 Recombinant monoclonal antibody, PBS Only (Detector) (85432-1-PBS)

• 

  Sandwich ELISA standard curve of MP01950-1

  Sandwich ELISA standard curve of MP01950-1, Human CTR9 Recombinant Matched Antibody Pair - PBS only. 85432-2-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag15690. 85432-1-PBS was HRP conjugated as the detection antibody. Range: 1.56-100 ng/mL

• 

  Sample test of MP01950-1

  The mean CTR9 concentration was determined to be 864.35 ng/mL in HeLa cell extract based on a 4.5 mg/mL extract load and 590.41 ng/mL in HEK-293 cell extract based on a 2.1 mg/mL extract load.

• 

  Cytometric bead array standard curve of MP01950-1

  Cytometric bead array standard curve of MP01950-1, CTR9 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 85432-2-PBS. Detection antibody: 85432-1-PBS. Standard: Ag15690. Range: 0.781-100 ng/mL.

CTR9 Uni-rAb^® Recombinant Antibody for Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 85432-1-PBS

Clone No.242949D12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

KIAA0155, p150, RNA polymerase-associated protein CTR9 homolog, SH2 domain-binding protein 1, SH2BP1

---

Product Information

85432-1-PBS targets CTR9 as part of a matched antibody pair:

MP01950-1: 85432-2-PBS capture and 85432-1-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag15690

  Product name: Recombinant human CTR9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-338 aa of BC058914

  Sequence: MSRGSIEIPLRDTDEVIELDFDQLPEGDEVISILKQEHTQLHIWIALALEYYKQGKTEEFVKLLEAARIDGNLDYRDHEKDQMTCLDTLAAYYVQQARKEKNKDNKKDLITQATLLYTMADKIIMYDQNHLLGRACFCLLEGDKMDQADAQFHFVLNQSPNNIPALLGKACISFNKKDYRGALAYYKKALRTNPGCPAEVRLGMGHCFVKLNKLEKARLAFSRALELNSKCVGALVGLAVLELNNKEADSIKNGVQLLSRAYTIDPSNPMVLNHLANHFFFKKDYSKVQHLALHAFHNTEVEAMQAESCYQLARSFHVQEDYDQAFQYYYQATQFASS

• Full Name: Ctr9, Paf1/RNA polymerase II complex component, homolog (S. cerevisiae)
• Calculated Molecular Weight: 1173 aa, 134 kDa
• GenBank Accession Number: BC058914
• Gene Symbol: CTR9
• Gene ID (NCBI): 9646
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q6PD62
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.