CTR9 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• CTR9 Recombinant monoclonal antibody (85432-4-RR)

• 

  WB analysis using 85432-4-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 85432-4-RR (CTR9 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

CTR9 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 85432-4-RR

Clone No.242949B10

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

242949B10, KIAA0155, p150, RNA polymerase-associated protein CTR9 homolog, SH2 domain-binding protein 1

---

Tested Applications

• Positive WB detected in: HEK-293 cells, L02 cells, mouse lung tissue, rat testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

85432-4-RR targets CTR9 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag15690

  Product name: Recombinant human CTR9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-338 aa of BC058914

  Sequence: MSRGSIEIPLRDTDEVIELDFDQLPEGDEVISILKQEHTQLHIWIALALEYYKQGKTEEFVKLLEAARIDGNLDYRDHEKDQMTCLDTLAAYYVQQARKEKNKDNKKDLITQATLLYTMADKIIMYDQNHLLGRACFCLLEGDKMDQADAQFHFVLNQSPNNIPALLGKACISFNKKDYRGALAYYKKALRTNPGCPAEVRLGMGHCFVKLNKLEKARLAFSRALELNSKCVGALVGLAVLELNNKEADSIKNGVQLLSRAYTIDPSNPMVLNHLANHFFFKKDYSKVQHLALHAFHNTEVEAMQAESCYQLARSFHVQEDYDQAFQYYYQATQFASS

• Full Name: Ctr9, Paf1/RNA polymerase II complex component, homolog (S. cerevisiae)
• Calculated Molecular Weight: 1173 aa, 134 kDa
• Observed Molecular Weight: 140 kDa
• GenBank Accession Number: BC058914
• Gene Symbol: CTR9
• Gene ID (NCBI): 9646
• RRID: AB_3744213
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q6PD62
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CTR9, also named as KIAA0155 and SH2BP1, contains 16 TPR repeats. It is widely expressed.