CUGBP1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86227-3-RR (same clone as 86227-3-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86227-3-RR (CUGBP1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86227-3-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 86227-3-RR

  Biolayer interferometry (BLl) kinetic assays of 86227-3-RR against Human CUGBP1 were performed. The affinity constant is 0.55 nM.

CUGBP1 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 86227-3-PBS

Clone No.250200A11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

50 kDa nuclear polyadenylated RNA-binding protein, Bruno like protein 2, BRUNOL2, Bruno-like protein 2, CELF 1

---

Product Information

86227-3-PBS targets CUGBP1 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag3677

  Product name: Recombinant human CUGBP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 107-479 aa of BC031079

  Sequence: DRKLFIGMISKKCTENDIRVMFSSFGQIEECRILRGPDGLSRGCAFVTFTTRAMAQTAIKAMHQAQTMEGCSSPMVVKFADTQKDKEQKRMAQQLQQQMQQISAASVWGNLAGLNTLGPQYLALLQQTASSGNLNTLSSLHPMGGLNAMQLQNLAALAAAASAAQNTPSGTNALTTSSSPLSVLTSSAGSSPSSSSSNSVNPIASLGALQTLAGATAGLNVGSLAGMAALNGGLGSSGLSNGTGSTMEALTQAYSGIQQYAAAALPTLYNQNLLTQQSIGAAGSQKEGPEGANLFIYHLPQEFGDQDLLQMFMPFGNVVSAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQSMNGFQIGMKRLKVQLKRSKND

• Full Name: CUG triplet repeat, RNA binding protein 1
• Calculated Molecular Weight: 483 aa, 52 kDa
• Observed Molecular Weight: 51-55 kDa
• GenBank Accession Number: BC031079
• Gene Symbol: CUGBP1
• Gene ID (NCBI): 10658
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q92879
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CUG triplet repeat RNA binding protein 1 (CUGBP1) is a member of the CUGBP Elav-like family (CELF), which plays an important role in cardiac development and function (PMID: 17130239). CUGBP1 has also been shown to localize to cytoplasmic stress granules when cells are stressed.