CUL3 Recombinant monoclonal antibody, PBS Only (Capture)

• 

  Sandwich ELISA standard curve of MP00599-4

  Sandwich ELISA standard curve of MP00599-4, Human CUL3 Recombinant Matched Antibody Pair - PBS only. 83619-7-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag1555. 83619-1-PBS was HRP conjugated as the detection antibody. Range: 1.25-80 ng/mL

• 

  Sample test of MP00599-4

  Hela and Jurkat cell lysates were measured. The human CUL3 concentration of detected samples was determined to be 144.2 ng/mL (based on a 1.2 mg/mL extract load) in Hela cell lysate and 475.5 ng/mL (based on a 1.0 mg/mL extract load) in Jurkat cell lysate.

CUL3 Uni-rAb^® Recombinant Antibody for Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 83619-7-PBS

Clone No.240534A8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

KIAA0617, Cullin-3, CUL-3, 240534A8

---

Product Information

83619-7-PBS targets CUL3 as part of a matched antibody pair:

MP00599-4: 83619-7-PBS capture and 83619-1-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1555

  Product name: Recombinant human CUL3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 469-768 aa of BC039598

  Sequence: KLEGMFRDMSISNTTMDEFRQHLQATGVSLGGVDLTVRVLTTGYWPTQSATPKCNIPPAPRHAFEIFRRFYLAKHSGRQLTLQHHMGSADLNATFYGPVKKEDGSEVGVGGAQVTGSNTRKHILQVSTFQMTILMLFNNREKYTFEEIQQETDIPERELVRALQSLACGKPTQRVLTKEPKSKEIENGHIFTVNDQFTSKLHRVKIQTVAAKQGESDPERKETRQKVDDDRKHEIEAAIVRIMKSRKKMQHNVLVAEVTQQLKARFLPSPVVIKKRIEGLIEREYLARTPEDRKVYTYVA

• Full Name: cullin 3
• Calculated Molecular Weight: 89 kDa
• GenBank Accession Number: BC039598
• Gene Symbol: CUL3
• Gene ID (NCBI): 8452
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q13618
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.