• Featured Product
  • KD/KO Validated

CUL7 Monoclonal antibody, PBS Only

CUL7 Monoclonal Antibody for WB, IHC, Indirect ELISA
Cat No. 67034-1-PBS
Clone No.2E3G9

Host / Isotype

Mouse / IgG2a

Reactivity

Human, Mouse, Rat

Applications

WB, IHC, Indirect ELISA

CUL 7, CUL7, cullin 7, dJ20C7.5, KIAA0076

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67034-1-PBS targets CUL7 in WB, IHC, Indirect ELISA applications and shows reactivity with Human, Mouse, Rat samples.

Tested Reactivity Human, Mouse, Rat
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag6943

Product name: Recombinant human CUL7 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1348-1698 aa of BC033647

Sequence: GKEHKSEKEEEAGAAAVVDVAEGEEEEEENEDLYYEGAMPEVSVLVLSRHSWPVASICHTLNPRTCLPSYLRGTLNRYSNFYNKSQSHPALERGSQRRLQWTWLGWAELQFGNQTLHVSTVQMWLLLYLNDLKAVSVESLLAFSGLSADMLNQAIGPLTSSRGPLDLHEQKDIPGGVLKIRDGSKEPRSRWDIVRLIPPQTYLQAEGEDGQNLEKRRNLLNCLIVRILKAHGDEGLHIDQLVCLVLEAWQKGPCPPRGLVSSLGKGSACSSTDVLSCILHLLGKGTLRRHDDRPQVLSYAVPVTVMEPHTESLNPGSSGPNPPLTFHTLQIRSRGVPYASCTATQSFSTFR

Predict reactive species
Full Name cullin 7
Calculated Molecular Weight 1698 aa, 191 kDa
Observed Molecular Weight 185 kDa
GenBank Accession NumberBC033647
Gene Symbol CUL7
Gene ID (NCBI) 9820
RRIDAB_2882349
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ14999
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

he cullin family proteins are scaffold proteins for the Ring finger type E3 ligases, participating in the proteolysis through the ubiquitin-proteasome pathway. Humans express seven cullin proeins: CUL1-3, CUL4A, CUL4B, CUL5, and CUL7. Each cullin protein can form an E3 ligase similar to the prototype Ring-type E3 ligase Skp1-CUL1-F-box complex. The Cullin-RING-finger type E3 ligases are important regulators in early embryonic development, as highlighted by genetic studies demonstrating that knock-out of CUL1, CUL3, or CUL4A in mice results in early embryonic lethality. CUL7 was originally discovered as 185-kDa protein associated with the large T antigen of simian virus 40 (SV40). CUL7-deficient mice exhibit neonatal lethality with reduced size and vascular defects. CUL7 presumably plays a role in the DNA damage response by limiting p53 activity. CUL7 mutations have also been identified in 3-Msyndrome and the Yakuts short stature syndrome, both of which are characterized by pre- and post-natal growth retardation but with relatively normal mental and endocrine functions, suggesting that CUL7 may also be crucial for human placental development.

Loading...
||
New chat Able
正在加载,请稍候...