CUTA Polyclonal antibody

• 

  WB analysis using 15610-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15610-1-AP (CUTA antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  IF Staining of A549 using 15610-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed A549 cells using CUTA antibody (15610-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

CUTA Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 15610-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

Acetylcholinesterase-associated protein, ACHAP, C6orf82, Protein CutA

---

Tested Applications

• Positive WB detected in: IMR-32 cells, THP-1 cells
• Positive IF/ICC detected in: A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15610-1-AP targets CUTA in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8000

  Product name: Recombinant human CUTA protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-156 aa of BC005890

  Sequence: MPALLPVASRLLLLPRVLLTMASGSPPTQPSPASDSGSGYVPGSVSAAFVTCPNEKVAKEIARAVVEKRLAACVNLIPQITSIYEWKGKIEEDSEVLMMIKTQSSLVPALTDFVRSVHPYEVAEVIALPVEQGNFPYLQWVRQVTESVSDSITVLP

• Full Name: cutA divalent cation tolerance homolog (E. coli)
• Calculated Molecular Weight: 19 kDa
• Observed Molecular Weight: 15 kDa
• GenBank Accession Number: BC005890
• Gene Symbol: CUTA
• Gene ID (NCBI): 51596
• RRID: AB_3669214
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O60888
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CUTA also known as ACHAP, functions in cellular copper sensitivity and in the processing and trafficking of membrane proteins. CUTA, the mammalian CutA divalent cation tolerance homolog (E. coli), has been proposed to mediate acetylcholinesterase activity and copper homeostasis. Human CUTA has several variants that differ in N-terminal length and are separated as heavy (H) and light (L) components. The H component of human CUTA was associated with the membrane fraction, whereas the L component of human CUTA was in the cytosol(PMID: 22351782).