Tested Applications
| Positive IHC detected in | human liver tissue, human breast cancer tissue, human colon cancer tissue, human stomach tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10468-1-AP targets CXCL14 in IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0747 Product name: Recombinant human CXCL14 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-111 aa of BC003513 Sequence: MSLLPRRAPPVSMRLLAAALLLLLLALYTARVDGSKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE Predict reactive species |
| Full Name | chemokine (C-X-C motif) ligand 14 |
| Calculated Molecular Weight | 13 kDa |
| Observed Molecular Weight | 13 kDa |
| GenBank Accession Number | BC003513 |
| Gene Symbol | CXCL14 |
| Gene ID (NCBI) | 9547 |
| RRID | AB_2086070 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O95715 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CXCL 14 (C-X-C motif chemokine 14) is a small inducible cytokine, and may be a potent chemoattractant for neutrophils. CXCL14 possesses a destruction box (D-box) domain which acts as a recognition signal for degradation via the ubiquitin-proteasome pathway. CXCL14 is widely expressed in normal tissues including heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas without inflammatory stimuli. It is dispensable for dendritic cell function and localization within peripheral tissues. In localized prostate cancer, CXCL14 mRNA was significantly upregulated and positively correlated with Gleason score.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CXCL14 antibody 10468-1-AP | Download protocol |
| IHC protocol for CXCL14 antibody 10468-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The CXCL14 antibody (Cat# 10468-1-AP) has 16 total citations. These appear in journals including Advanced Science, Journal for ImmunoTherapy of Cancer, NPJ Precision Oncology, Journal of Translational Medicine, JCI Insight, Thyroid, Translational Research, International Immunopharmacology, Frontiers in Pharmacology, American Journal of Respiratory Cell and Molecular Biology, Disease Models & Mechanisms, Journal of Cancer, Journal of Neuroscience Research, Journal of Gene Medicine, and Cell Reports Medicine. Research fields span oncology (gastric, bladder, colorectal, renal, breast, ovarian, oral cancers), immunotherapy resistance, autoimmune disease, reproductive endocrinology, respiratory inflammation, and neurodegeneration.
| Species | Application | Title |
|---|---|---|
Adv Sci (Weinh) Three-Year Follow-Up of Neoadjuvant Tislelizumab with Chemotherapy in Locally Advanced Gastric and Gastroesophageal Junction Adenocarcinoma: Revealing Cancer-Associated Fibroblast Heterogeneity Corresponding to PD-1 Blockade Efficacy. | ||
J Immunother Cancer Overcoming immunotherapy resistance in bladder cancer with a novel antibody-drug conjugate RC48 | ||
NPJ Precis Oncol Integrated single-cell and spatial transcriptomics reveals a multicellular program contributing to immunotherapy resistance and adverse clinical outcomes in clear cell renal cell carcinoma. | ||
J Transl Med Single-cell analysis reveals an endothelial TP53-CXCL14 axis in breast cancer progression. | ||
J Transl Med Chemokine CXCL14 is associated with prognosis in patients with colorectal carcinoma after curative resection.
| ||
