CXCL16 Recombinant monoclonal antibody, PBS Only (Detector)

CXCL16 Uni-rAb® Recombinant Antibody for Cytometric bead array, Indirect ELISA
Cat No. 85680-2-PBS
Clone No.242984H2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

C X C motif chemokine 16, C-X-C motif chemokine 16, CXCL 16, Scavenger receptor for phosphatidylserine and oxidized low density lipoprotein, Small-inducible cytokine B16

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85680-2-PBS targets CXCL16 as part of a matched antibody pair:

MP02039-1: 85680-3-PBS capture and 85680-2-PBS detection (validated in Cytometric bead array)

MP02039-2: 85680-1-PBS capture and 85680-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg2165

Product name: Recombinant Human CXCL16 protein (rFc Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-rFc

Tag: C-rFc

Domain: 30-205 aa of BC017588

Sequence: NEGSVTGSCYCGKRISSDSPPSVQFMNRLRKHLRAYHRCLYYTRFQLLSWSVCGGNKDPWVQELMSCLDLKECGHAYSGIVAHQKHLLPTSPPISQASEGASSDIHTPAQMLLSTLQSTQRPTLPVGSLSSDKELTRPNETTIHTAGHSLAAGPEAGENQKQPEKNAGPTARTSAT

Predict reactive species
Full Name chemokine (C-X-C motif) ligand 16
Calculated Molecular Weight 273 aa, 30 kDa
GenBank Accession NumberBC017588
Gene Symbol CXCL16
Gene ID (NCBI) 58191
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9H2A7
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.
Loading...
||
New chat Able
正在加载,请稍候...